Details for Kale Locus Bo5g150320

Position : C5 ( 5`- 46264210 .. 46265269 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150320

Protein [Map View]
MASSSSSSSLSFITFLLLAPLCFCSEPPLQIPNGTLDLSLLWYGQFTRVQKERVQDFIESLNFDSKEGLDPKVSAWWKLV
ESYQERYEVKEIYRQKSKRTVAPRIKVKIVRSFVDEKMKYGKELTIENGEKLVDTAIENMSKVVPVVLLSAQVRSHGLGF
CNKTCQRYALTRNGKEKPQPYVMVSDPEVQCPGECAWPFHISNEGPHGMTYQPPSGEIGADALVIQLATGLADVATNPAL
SESLFKSEPPYITEGNHISSDYIVDPATKCTRVFGSGAFPGFTGRIRVDPVTGGAFNSHGINHLKFLIPSVWDPKTKSCW
TPM*

DNA
ATGGCATCTTCTTCTTCTTCCTCCTCCTTATCCTTCATTACCTTCCTCCTCTTGGCGCCTCTCTGCTTTTGTAGTGAGCC
ACCTTTGCAAATACCAAACGGAACCTTGGATCTCTCGTTACTCTGGTACGGACAATTCACGCGGGTCCAGAAAGAGAGGG
TTCAAGATTTCATAGAATCGCTCAACTTTGACAGCAAGGAAGGTCTTGACCCCAAGGTATCAGCGTGGTGGAAACTGGTG
GAGAGTTATCAAGAGAGGTATGAGGTCAAGGAGATATACCGACAGAAGAGTAAAAGAACCGTAGCTCCGAGGATTAAGGT
GAAGATTGTCCGGAGCTTTGTGGATGAGAAGATGAAGTATGGTAAGGAGTTAACAATCGAAAACGGTGAGAAACTGGTTG
ACACTGCCATCGAAAACATGTCAAAAGTGGTTCCTGTGGTTTTACTTTCGGCACAAGTTAGGTCTCATGGCCTAGGGTTT
TGTAACAAAACTTGCCAACGCTACGCCCTTACCCGCAATGGTAAAGAAAAACCACAACCATACGTAATGGTGAGCGACCC
GGAGGTGCAGTGTCCCGGAGAGTGCGCTTGGCCTTTCCACATTTCTAATGAAGGTCCGCATGGCATGACCTATCAACCAC
CAAGTGGTGAAATAGGAGCTGATGCGTTGGTTATTCAGCTAGCCACCGGTTTAGCAGACGTTGCCACCAATCCAGCTTTA
AGCGAATCCTTATTCAAATCTGAGCCACCGTACATCACCGAGGGAAACCACATCTCTTCGGATTATATAGTGGACCCTGC
AACCAAGTGCACACGCGTATTTGGATCCGGAGCTTTTCCTGGTTTCACTGGAAGAATCCGGGTTGACCCGGTAACTGGTG
GAGCCTTTAACTCACATGGAATCAACCACTTGAAGTTCTTGATTCCTTCTGTTTGGGACCCTAAGACCAAATCCTGCTGG
ACTCCGATGTAA