Details for Kale Locus Bo5g150270

Position : C5 ( 5`- 46248396 .. 46249077 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150270

Protein [Map View]
MASNLLKALIRSQILPSSRRNFSVAAASTQLGIPTDDLVGNHTARWMQDRSKKSPMELINEVPPIKVVGRTAACEGDTNP
ALGHPIEFICLDLHEPAVCKYCGLRYVQDHHH*

DNA
ATGGCGTCGAATCTCCTGAAAGCTCTGATCCGATCGCAGATTCTCCCATCTTCGAGGAGGAACTTTAGCGTGGCGGCGGC
TAGCACTCAGCTCGGCATTCCAACAGACGATTTAGTCGGAAACCACACGGCCAGATGGATGCAGGATAGGAGCAAGAAGT
CACCAATGGAACTGATCAATGAGGTTCCACCTATCAAGGTTGTTGGAAGGACTGCTGCTTGTGAAGGAGACACCAATCCA
GCACTGGGTCATCCAATTGAGTTCATTTGCCTCGACCTACACGAGCCTGCTGTCTGCAAGTACTGTGGCCTTCGTTATGT
TCAAGATCATCATCACTAA