Details for Kale Locus Bo5g150250

Position : C5 ( 5`- 46240291 .. 46243373 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150250

Protein [Map View]
MGFDAEKQSIVSLGQIGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGALLFGYEIGATSCATISIKSPKL
SGISWYNLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKELILAALLYLVGAIVTAVAPVFYVLIIGRLMYGIGVGL
TMHAAPMYIAETAPSQIRGRMISLKEFFTVLGMVGGYGIGSLWVTVTSGWRYMYATIIPLPVIMGIGMCWLPASPRWLLL
RSLQGKGNVERLQQAAIKSLRRLRGSVVVDSAAEQVNEILAELSSVGEDKEATLGELFQGKCLKALTIAGGLVLLQQITG
QPSVLYYAPSILQTAGFSAATDATRISILLGLLKLVMTGVAVIVIDRLGRRPLLLGGVSGMMISLLLLGSYYIFYNTVPA
VAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCGFGVICVVSL
FFIYFIVPETKGLTLEEIEAKCL*

DNA
ATGGGGTTTGATGCCGAGAAACAATCGATCGTTTCTCTTGGACAGATTGGTGATTCATCTTCAGGTGAGATTAGCTCAGA
GAAACAACCTCTGATCAAAGAGAACCACCACAGCCCAGAAAACTACTCTGTTCTTGCAGCCATCCCCCCGTTTCTCTTTC
CAGCTCTTGGAGCGTTGCTTTTTGGTTACGAGATTGGTGCCACTTCTTGTGCTACCATTTCTATTAAGTCGCCTAAGCTA
AGTGGAATCTCATGGTACAACTTGTCTTCAGTGGATGTTGGTATCATTACTAGTGGCTCACTGTACGGTGCCTTAATTGG
ATCCATTGTGGCATTTAGTGTTGCTGACATTATAGGAAGAAGAAAGGAGCTGATTTTGGCTGCGCTCTTATATCTTGTTG
GAGCCATTGTGACTGCAGTGGCACCTGTCTTCTATGTCCTGATTATTGGACGGCTTATGTATGGCATCGGTGTTGGACTG
ACAATGCACGCGGCTCCGATGTACATTGCAGAGACTGCTCCTAGTCAGATACGTGGACGGATGATCTCACTGAAAGAGTT
CTTTACCGTCCTTGGGATGGTTGGAGGTTATGGAATAGGTAGCCTTTGGGTTACGGTTACCTCTGGTTGGCGTTACATGT
ACGCAACGATCATCCCTTTGCCGGTTATCATGGGAATTGGAATGTGCTGGCTACCAGCATCCCCTAGGTGGCTGTTACTG
CGCTCTCTCCAAGGTAAAGGGAATGTGGAGAGACTTCAACAGGCGGCAATCAAGTCTCTTCGCCGTCTTAGAGGGTCTGT
GGTAGTTGACTCAGCCGCTGAGCAAGTGAACGAGATCTTGGCTGAACTTTCCTCTGTGGGCGAGGATAAAGAAGCTACAC
TTGGTGAGTTGTTTCAAGGGAAATGCTTGAAGGCTCTCACTATAGCAGGAGGTTTAGTCTTGTTGCAACAGATAACTGGG
CAACCAAGTGTACTTTATTATGCACCATCAATACTTCAGACTGCTGGCTTCTCTGCTGCAACTGATGCAACTCGGATCTC
AATTCTGCTCGGTCTATTGAAGTTGGTTATGACTGGAGTTGCTGTTATAGTGATTGACAGACTTGGAAGGAGGCCTTTAC
TTCTTGGTGGTGTTAGTGGCATGATGATCTCACTGCTCCTCCTGGGGTCATACTACATCTTTTACAATACTGTACCAGCT
GTGGCTGTAGTTGCATTGCTACTGTATGTGGGCTGCTATCAGTTGTCCTTTGGTCCTATTGGTTGGCTGATGATTTCAGA
GATATTCCCCTTAAAACTAAGAGGCAGAGGGATCAGCATAGCAGTGCTTGTGAATTTCGGCACAAACGCGCTTGTGACAT
TCGCTTTCTCACCTCTAAAGGAGCTGTTAGGAGCTGGAGTATTGTTCTGTGGATTTGGAGTGATATGTGTAGTGTCTCTC
TTCTTCATATACTTCATTGTGCCTGAGACAAAGGGTCTTACTCTTGAAGAGATTGAAGCCAAATGTCTCTAA