Details for Kale Locus Bo5g150230

Position : C5 ( 5`- 46228037 .. 46234399 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150230

Protein [Map View]
MAAERLRDLSKPMDVALLDATVDFFYATGSKEERAAADNILRDLKANPDTWLQVAHILQNTRSTHTKYFALQVLEGVIKY
RWKALPVVQRDGMKMYISDVIVQLSKNEASFRSERFYINKLNLILVQILKHEWPANWRSFIPDLVNAAKTSESICENGMA
ILKLLSEEIFNFSKGEMIQRKINDLKESLNRQLETLLTFFSVPAYRNLTLQCLSKVAALKYEKHYRNQVVQMYMIFMKHL
EGMLPFNINIPEAYSAGSNEEQASLLRANILYFTAFIQNLALFFTSFFKLHINILETTSETIPFLLAGLEYLIKISYVDD
TEVFKVCCDYWHLLVSELFTSGQRMVFHPPTVGSIEPEITTPKILYSDQLSKLRGLMINSMAKPEEVLIVEDENGNIVRE
TMKDCDVFLQYRIMRETLIFLTHFDNDDTERQMLSKLSKQINKKEWTRNDLNTLCWAIGSISGSMDVANEDRFLVKVIRA
LLSFSGIMKGNDDKDVIASNIMYVFGQYPRFLKGNWQYMMVVVKKLFDFMHSTQPGVKDMACDTFLKIAQQCKHIFLVVQ
VGKEEPFVSEVLASLSTTTKHLGPHQIQTFYESVACIIEAESDPQKRREYIEWLMALPNQRWAEIIGEARQNVDFLKDPD
VIHNVLTILQTNTRVAASLGKYFLFQISSIFLAILNIYKMYSELVSSSIGDSGPCASRISLIKLLRSVKREILNLIKTFL
DKDEKNPHIGKHFVPPIMNEILADYARNVPDARESEVLSLFATIINQYKVAMQDDVPRIFESVFHCTLEMITKNFEDYPE
HRLKFFLLLRAIATFCFRALLQLSSEQLKLVMDSVIWAFRHTERNIAETGLKLLLVLLKKFQKSAFSNQFYRTYLMQIEQ
EIIAVLTDTFHKPEFHWHVFVLQRLFQLVESGALTEPLWDASTVPQQYPDNAAFVCDHTTKLLSSSFPNISVPEVTEFVK
GLYELRDHPVPFKNNVRDFLIRSKEFSAQDNKDLDAGPIAPDENPDEMSDS*

DNA
ATGGCTGCTGAGAGGTTAAGGGACTTGAGTAAGCCTATGGACGTCGCTTTACTCGATGCCACCGTTGATTTCTTTTATGC
TACAGGATCTAAGGAAGAAAGAGCTGCTGCGGATAATATTTTACGGGATTTGAAAGCTAATCCTGATACTTGGCTTCAAG
TGGCTCACATCCTGCAGAACACCAGGAGTACGCATACCAAGTATTTTGCCCTTCAGGTGCTAGAAGGTGTTATCAAATAT
AGGTGGAAGGCATTACCAGTTGTACAACGTGATGGAATGAAAATGTACATCTCTGACGTCATTGTGCAGCTTTCAAAGAA
CGAAGCATCTTTCAGATCGGAAAGGTTTTATATCAACAAGTTAAATCTCATCTTGGTTCAGATCTTGAAACATGAATGGC
CGGCGAACTGGAGAAGCTTTATACCTGATCTAGTTAATGCTGCTAAAACCAGCGAATCTATCTGTGAGAATGGCATGGCT
ATTTTGAAACTCCTAAGTGAAGAGATCTTTAATTTCTCAAAAGGAGAGATGATTCAGAGAAAGATAAACGATCTGAAAGA
GTCTCTAAACAGGCAACTGGAAACCCTCCTTACGTTCTTCTCTGTGCCGGCATACAGGAATCTCACTCTTCAATGTCTGT
CAAAGGTTGCAGCACTTAAATATGAAAAGCACTACAGAAACCAAGTTGTCCAAATGTACATGATTTTCATGAAACATTTG
GAGGGAATGCTTCCTTTTAATATTAATATCCCAGAGGCATATTCAGCTGGAAGTAATGAAGAACAGGCAAGTCTTTTACG
TGCAAATATTTTATATTTTACGGCTTTTATCCAGAACTTGGCACTGTTTTTCACTTCGTTTTTCAAGCTACATATAAATA
TCCTAGAAACTACATCCGAAACTATTCCCTTCCTACTTGCTGGTCTGGAATATCTCATTAAAATATCATATGTTGATGAC
ACTGAAGTGTTCAAGGTTTGTTGTGACTACTGGCATTTACTAGTTTCGGAGTTGTTTACATCAGGTCAACGAATGGTTTT
TCATCCTCCTACGGTTGGGAGCATCGAACCTGAAATCACAACACCAAAAATACTTTACTCTGATCAACTATCAAAATTAA
GGGGGCTCATGATTAATAGCATGGCTAAGCCTGAAGAAGTGCTAATTGTTGAAGATGAAAATGGGAACATTGTCCGCGAA
ACTATGAAGGATTGTGATGTTTTTCTCCAGTATAGGATAATGCGGGAGACATTGATCTTCCTCACACACTTCGATAATGA
TGACACTGAAAGACAGATGTTGAGTAAGCTAAGCAAACAGATAAACAAAAAAGAATGGACACGGAATGATCTGAACACTT
TGTGCTGGGCTATTGGGTCTATTTCTGGTTCCATGGATGTAGCAAATGAAGACAGATTTCTAGTGAAGGTTATTCGTGCT
TTATTAAGTTTCAGTGGAATCATGAAGGGAAATGACGATAAAGATGTTATCGCGAGCAACATCATGTATGTTTTTGGACA
GTATCCAAGATTCTTAAAGGGCAATTGGCAGTATATGATGGTGGTTGTTAAGAAGTTGTTTGACTTCATGCATTCGACTC
AACCGGGTGTTAAGGACATGGCTTGTGATACATTCTTAAAGATTGCTCAGCAATGCAAACACATATTCCTTGTTGTTCAG
GTTGGAAAAGAGGAGCCATTTGTATCTGAAGTTCTAGCAAGCCTTAGTACAACTACTAAACATCTTGGGCCTCATCAGAT
TCAAACTTTTTATGAATCTGTTGCTTGTATAATCGAGGCTGAATCAGATCCTCAGAAGAGACGTGAATACATCGAGTGGT
TGATGGCTCTCCCTAATCAGAGATGGGCAGAGATTATAGGAGAAGCACGTCAGAATGTTGATTTCCTCAAAGACCCTGAT
GTGATACATAATGTGCTTACTATCCTCCAAACAAATACAAGAGTTGCAGCTTCACTGGGAAAATACTTCTTATTTCAAAT
TTCATCGATCTTCTTGGCTATTCTGAATATTTACAAGATGTACAGTGAACTCGTGTCAAGCAGCATTGGTGATAGTGGCC
CGTGTGCTTCGAGGATATCTTTGATTAAGCTTCTAAGGTCTGTTAAGAGAGAAATCCTGAACCTGATAAAAACGTTTCTA
GACAAAGATGAAAAAAACCCACACATTGGCAAACATTTTGTTCCACCAATTATGAATGAAATACTTGCTGACTATGCAAG
AAATGTTCCTGATGCAAGGGAATCAGAAGTTTTATCACTCTTTGCGACAATAATAAACCAGTACAAGGTTGCAATGCAAG
ATGATGTGCCTCGCATCTTTGAATCTGTTTTCCATTGCACTTTGGAGATGATCACTAAGAATTTTGAAGATTATCCAGAA
CACCGGCTCAAGTTTTTCTTGTTACTTCGTGCCATTGCTACATTTTGTTTCCGTGCATTGCTACAGTTGTCAAGTGAGCA
ACTGAAGCTAGTCATGGATTCGGTTATCTGGGCGTTTAGGCATACCGAAAGAAACATCGCTGAAACAGGACTTAAACTCT
TACTTGTGTTGCTGAAAAAGTTTCAGAAATCTGCTTTCTCTAACCAATTCTACCGGACATACTTAATGCAAATTGAGCAA
GAAATTATTGCCGTGTTGACCGATACCTTTCACAAGCCAGAGTTCCATTGGCATGTGTTCGTGCTACAGCGTCTATTTCA
ACTGGTGGAGAGCGGTGCTTTGACCGAACCTTTGTGGGATGCTTCAACGGTGCCTCAACAGTATCCAGATAACGCCGCCT
TTGTTTGTGATCACACCACCAAGCTTCTAAGCTCGTCATTCCCCAACATAAGTGTACCAGAGGTGACAGAATTTGTGAAA
GGACTTTATGAGTTGAGAGATCACCCTGTTCCATTTAAGAATAACGTACGAGACTTCCTTATACGGTCCAAAGAATTTTC
TGCTCAGGATAACAAAGATTTAGATGCTGGACCTATTGCTCCCGACGAGAATCCAGATGAGATGAGTGATTCATAA