Details for Kale Locus Bo5g150210

Position : C5 ( 5`- 46222587 .. 46225202 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150210

Protein [Map View]
MEGAADCTVGSIVWVRRRNGSWWPGKILGQDDLDSTHITSPRSGTPVKLLGREDASVDWYNLEKSKRVKPFRCGDFDDCI
EKVENSQGLTIRKREKYARREDAILHALELEKEILKKEVKVETGRPRARARARGDSPDAAAKERMVVSRVHDISNGGLRR
NHVGDVRHLHKDKEEEQTRFEEEAQPRMRGLQDFGLRTASSKRKFSSSNGPADTSFKSLARSNSSASSSGDYSMERPSFT
LGKEKTRNSMEAKRTKYMFAPNESNDVLDLHESLLSHRAAMHSSFAGGDHSRYSLSEYDPPEFLEDVESVSSESETDSSD
MEEDTDDDIPLLSGAGRHSEQHNPFSSRHMSAEDESTSSEEDCYESSMSGDSSHLYSQDPDNEAGTVSKWQLKGKRNMRN
LPRRSARNGRYSEYKRRAFGQKPMGYGLDSSGTNDMSDGTDDTDPNERQFRDRMTGPGDDEYRLSTMVASGFKNIYSHDM
LDWDDDPWEGQIGKKKRWEERLEGSGQEFHASSHRHSRRNMYSPLMDVELEVRGSYQKGPVPIVSLMSKLNSRAIIGHPV
EVEVLADGSSEYFGNETTYHDKPFLLPHAWKTARRSSSRVPRLQPLSPSLEADADVHSPSGQGRKPFFKKLGSGNLSTDD
NSLRRSNLMHIPRPPGERKQQQKKVMKNTNATPSQKTRALSSFGSEQAHSGIKTFGDGTHELSNRRVLQGPPTVACIPVK
LVFSRLLEKINRPPSKPL*

DNA
ATGGAAGGTGCGGCTGATTGCACGGTGGGTTCGATTGTGTGGGTGAGGAGGAGGAACGGCTCGTGGTGGCCAGGGAAGAT
ACTGGGACAGGATGATCTTGACTCTACTCATATCACCTCTCCTCGATCTGGAACTCCTGTGAAGCTTCTTGGAAGAGAGG
ATGCGAGTGTGGATTGGTACAACTTAGAGAAGTCCAAGCGTGTGAAGCCGTTCCGGTGCGGCGATTTTGATGACTGCATT
GAGAAGGTGGAGAATTCGCAAGGGCTGACGATAAGGAAGAGGGAGAAGTATGCTCGTAGAGAAGACGCGATTCTCCATGC
GCTTGAGCTTGAGAAGGAGATTCTGAAGAAGGAAGTGAAAGTTGAGACTGGTAGGCCTAGGGCTAGGGCTAGGGCTAGGG
GGGACTCTCCTGATGCAGCAGCCAAGGAGAGAATGGTTGTGTCTAGGGTTCATGATATCTCTAATGGTGGTCTAAGGCGT
AACCATGTTGGTGATGTTAGGCATTTGCACAAAGATAAAGAGGAAGAACAGACGAGATTTGAGGAAGAGGCACAGCCTCG
GATGAGAGGGTTGCAGGACTTTGGGCTAAGAACCGCCTCTTCGAAGAGAAAGTTTTCATCTTCCAATGGTCCTGCTGATA
CTTCCTTCAAGTCTCTGGCGAGAAGCAACTCTTCAGCTTCTTCTAGTGGAGATTATAGCATGGAGAGGCCCAGTTTTACC
CTCGGAAAGGAAAAGACTAGGAACTCGATGGAGGCTAAAAGGACTAAATACATGTTTGCACCAAATGAATCTAATGATGT
TTTAGATCTGCATGAGAGTTTGCTAAGCCACAGGGCGGCAATGCATTCCTCCTTTGCTGGTGGTGACCATTCTCGTTATT
CGCTTTCAGAATATGACCCTCCTGAGTTTTTGGAAGATGTTGAATCTGTTTCTTCTGAATCCGAAACTGACTCTTCTGAT
ATGGAGGAGGATACTGATGATGACATTCCCTTGCTGTCAGGAGCTGGGCGTCATTCAGAGCAACACAATCCTTTCAGTAG
TAGACATATGTCAGCAGAAGATGAAAGCACCAGCAGTGAGGAAGACTGTTATGAATCATCCATGTCTGGCGACTCTTCTC
ACCTTTATTCCCAAGATCCAGATAATGAAGCTGGTACGGTTTCCAAGTGGCAGCTCAAGGGAAAGAGAAACATGCGCAAT
CTTCCAAGAAGGTCTGCACGTAACGGAAGATATTCTGAATATAAGAGAAGGGCATTTGGTCAAAAGCCTATGGGCTATGG
ATTAGATTCTAGTGGGACAAATGATATGAGCGATGGAACTGATGACACTGATCCCAACGAGAGACAGTTCCGGGACAGAA
TGACTGGACCAGGTGATGATGAGTATCGGCTCTCAACTATGGTTGCATCCGGATTCAAGAACATCTACAGCCATGACATG
CTGGACTGGGATGATGATCCTTGGGAAGGCCAGATTGGTAAGAAGAAGCGATGGGAGGAAAGACTCGAAGGTTCAGGTCA
GGAGTTCCATGCGTCTTCTCATCGACATTCTAGAAGAAATATGTATTCTCCGTTGATGGATGTGGAACTAGAAGTACGAG
GAAGCTATCAGAAAGGGCCTGTCCCAATTGTCTCCCTGATGAGTAAGTTAAACAGCAGAGCGATAATTGGACATCCAGTT
GAAGTTGAAGTCTTGGCAGATGGTTCCTCTGAGTACTTCGGCAATGAAACAACATACCATGACAAACCCTTTCTACTTCC
CCATGCTTGGAAGACCGCAAGAAGGAGTAGCTCACGCGTTCCACGGCTGCAACCATTATCACCATCTCTTGAAGCCGATG
CTGATGTTCATTCTCCGTCAGGTCAGGGAAGAAAACCGTTTTTTAAGAAACTTGGTTCGGGAAACTTAAGTACTGATGAT
AACTCGTTGCGGAGAAGCAATCTAATGCATATTCCACGACCACCTGGTGAGAGAAAGCAGCAGCAAAAGAAGGTGATGAA
GAACACAAACGCAACCCCTAGTCAAAAGACCAGGGCACTGTCATCATTCGGCAGTGAACAAGCACACAGCGGGATAAAGA
CCTTCGGTGATGGGACTCACGAGCTATCTAACAGACGGGTACTACAGGGACCACCAACCGTGGCTTGCATACCGGTCAAA
CTAGTATTTAGCAGATTACTGGAGAAAATAAACAGACCGCCATCAAAGCCGCTGTGA