Details for Kale Locus Bo5g150200

Position : C5 ( 5`- 46220436 .. 46221962 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150200

Protein [Map View]
MATRSKSFQLITGLRKLAVNPRASSRATATALFTTSRSGYSSGYDKNVEDELQATAVPDDVIKPDSDKYWSPHPQTGVFG
PSTTDQTAAAEAARQDSAVLEETAWFRPISLEDSDKTHHV*

DNA
ATGGCAACCAGATCGAAGAGCTTTCAACTGATCACCGGCCTAAGGAAGCTCGCTGTCAACCCACGCGCTTCCTCACGCGC
CACCGCCACTGCCCTATTTACTACTTCTCGGAGCGGTTATTCCTCGGGGTATGACAAGAACGTGGAGGATGAATTGCAGG
CAACTGCAGTTCCTGACGACGTCATAAAGCCAGATTCTGATAAATACTGGTCTCCTCATCCTCAAACCGGAGTCTTTGGC
CCTTCGACGACTGACCAGACTGCAGCAGCGGAGGCTGCTCGCCAAGACTCGGCGGTGCTGGAAGAGACTGCTTGGTTTCG
TCCCATAAGTCTCGAGGACTCGGACAAGACTCACCATGTTTAA