Details for Kale Locus Bo5g150190

Position : C5 ( 5`- 46217824 .. 46218474 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150190

Protein [Map View]
TFIIITIIVKIVLYKKPLFLLSSLDQLEAAFKKKKNMHYQEQMESLMLGEEHRRGNCVRDADEGFNSPSSFPNSPDDSVR
RSSSPLRRGLSKHYKGKSQSFTSLSEALTVEDLAKPENPFNVKLKQRRGNIHCRRLSGCGGASEQNLGVHDAFHSGNGRP
LRLSGNRAPLRAQTLSAAHISALLTRT*

DNA
ACGTTCATCATCATCACCATAATAGTAAAGATTGTTTTGTACAAAAAGCCACTGTTTCTGCTCTCAAGTCTTGATCAATT
AGAAGCGGCTTTCAAGAAGAAAAAAAATATGCACTATCAAGAACAGATGGAGTCTCTTATGTTGGGTGAAGAACACAGAC
GTGGAAACTGCGTTAGGGACGCAGACGAAGGTTTTAACTCTCCGTCTTCTTTTCCTAACTCTCCTGACGATTCGGTCCGT
CGCAGTTCATCTCCTTTAAGGAGAGGGTTGTCAAAACATTACAAAGGTAAATCTCAGTCATTCACGTCCTTGTCGGAAGC
TCTGACAGTTGAGGATCTCGCAAAACCCGAGAATCCTTTCAACGTGAAACTGAAGCAGCGACGGGGGAACATTCACTGTC
GACGGCTCTCCGGATGTGGAGGTGCATCGGAGCAAAACTTAGGCGTGCACGACGCTTTCCACTCCGGAAACGGTAGACCG
CTGCGACTTTCCGGTAACAGAGCGCCTCTGAGAGCCCAGACGCTCTCGGCTGCTCATATATCGGCATTGCTCACTCGCAC
CTAA