Details for Kale Locus Bo5g150170

Position : C5 ( 5`- 46208642 .. 46211084 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150170

Protein [Map View]
MAPVSLPPGFRFHPTDEELITYYLKRKINGLEIELEVIAEVDLYKCEPWDLPGKSLLPSKDQEWYFFSPRDRKYPNGSRT
NRATKGGYWKATGKDRRVSWRDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRLDENECEPYAYGMQDAYALCRVFKKIVI
EAKPRDQHRSYIHAMSNVSGNSSFDPCSDLEISSTTHQVQNAFQPQIGNGRFNSNASNENWSQYYGSSYPPFPTPYKVNN
EIECSMLQHNICLPPLRIENSAVSNYDFYNTSTTHNNDHGVLEDFTFAASNSNHYNNTVGDHVIHLGNYDEPLIMSNNYM
NQGYIEEQKIILTLDDNDQDLGFHGDNTNINIDIDDFFSFDMYNEENVNRVKGNEEDVNINEAVDSSGFEVVEEEIRVNN
QMLISTYQTTKILYHQVVPSHTLKVQINLINHNVEERILFIEEDNDSWVQRAEKITKIKLNLVSLIAQQYYKYLTIFF*

DNA
ATGGCTCCTGTCTCGTTACCTCCAGGTTTTAGATTTCATCCAACCGATGAGGAGCTGATTACCTACTATCTGAAAAGAAA
AATTAACGGTCTAGAAATCGAACTTGAGGTTATCGCTGAAGTTGATCTCTACAAGTGCGAGCCATGGGACTTGCCAGGAA
AGTCCTTGCTTCCGAGCAAAGACCAAGAATGGTACTTCTTCAGCCCACGAGACCGGAAGTATCCTAACGGTTCCAGGACA
AACCGAGCAACTAAAGGCGGGTACTGGAAGGCTACGGGTAAAGACCGCCGTGTTAGTTGGAGAGACCGAGCCATTGGAAC
CAAAAAGACATTAGTTTACTACCGTGGACGCGCGCCACATGGTATTAGAACCGGTTGGGTTATGCATGAATATCGACTCG
ATGAAAATGAATGCGAGCCTTATGCATACGGCATGCAGGACGCATATGCACTCTGTCGTGTGTTTAAAAAGATTGTGATT
GAAGCTAAGCCAAGAGATCAGCATCGTTCTTACATCCATGCTATGTCAAATGTGAGTGGAAATTCGAGTTTTGACCCTTG
TTCAGATCTAGAGATCAGTTCAACTACTCATCAAGTTCAAAACGCATTCCAACCTCAAATTGGAAACGGACGTTTTAATT
CAAACGCCAGTAACGAAAACTGGTCACAATACTATGGTTCTTCTTATCCACCGTTCCCTACTCCATATAAGGTTAATAAT
GAGATCGAATGCTCAATGTTACAACACAATATATGTCTACCACCGTTGCGTATAGAGAACTCTGCGGTCAGCAATTACGA
TTTCTATAATACGAGTACGACTCACAACAACGATCATGGCGTTTTGGAGGACTTTACTTTCGCTGCAAGTAACTCCAACC
ATTATAATAATACCGTTGGTGATCACGTGATCCATTTAGGCAACTATGATGAACCATTAATAATGTCAAATAATTATATG
AACCAGGGTTATATCGAAGAGCAGAAGATCATATTGACTTTGGATGATAATGACCAAGATCTTGGATTTCATGGAGACAA
TACCAATATCAACATAGATATTGATGACTTCTTCTCGTTTGATATGTATAACGAGGAAAACGTAAATCGAGTAAAAGGTA
ACGAAGAAGACGTGAATATAAATGAAGCCGTAGATTCATCGGGATTTGAGGTGGTTGAAGAAGAAATTAGGGTTAACAAC
CAAATGCTCATCTCGACATATCAAACGACGAAGATTCTATATCACCAAGTCGTACCATCTCACACGTTGAAAGTTCAGAT
TAATCTCATTAACCACAATGTGGAAGAGAGAATATTGTTCATTGAAGAAGATAACGATTCTTGGGTACAAAGAGCTGAGA
AGATCACGAAGATAAAACTAAATCTTGTTAGTTTAATAGCTCAGCAATATTACAAATATCTTACGATTTTTTTCTGA