Details for Kale Locus Bo5g150160

Position : C5 ( 5`- 46204995 .. 46206089 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150160

Protein [Map View]
MLGAIHFGVLAACFVLFVPMAMAGWHLSRHKMLFFSGALFISLAVCVHLTPYFPSVSDIVASVSSVVVYDHRVSCINEVN
QIVWDVRPRPRNNNGSSKLDYFEKNWDWVRSRKVQSCEFQKLDKLDVSELLNGSWIVVAGDSQARFVALSLLGLVLGSGS
EAMGSVREELFKRHSDYSIVVKEIGMKVDFVWAPYEKDLDDLVVSYKKKNKFPDVVIMGSGLWHMLHVNNASDFGFQLKE
LRSHVELLVPVRTKGEEGGGGSVSGRSMHMFWIGMPVLINGMLNTDEKKERMSDTVWHEYDRSLGESKILRQMGGPLVLL
DVQSFTWNCGPQCTLDGMHYDSAVYDAAVHVMLNALLIESNQTL*

DNA
ATGCTAGGAGCGATCCACTTCGGAGTATTAGCAGCGTGTTTCGTCCTCTTCGTCCCCATGGCCATGGCAGGCTGGCACCT
CAGCAGGCACAAGATGCTCTTCTTCAGCGGCGCTCTCTTCATCTCCCTCGCCGTCTGCGTCCACCTCACCCCTTACTTCC
CTTCCGTCTCCGACATCGTCGCCTCCGTCTCCTCCGTCGTCGTCTACGATCACCGCGTCTCGTGCATCAACGAGGTGAAC
CAGATCGTCTGGGACGTTAGGCCTCGACCTAGGAACAACAACGGTTCTTCGAAGCTCGATTACTTCGAGAAGAATTGGGA
TTGGGTGAGATCGAGGAAAGTTCAGAGCTGCGAGTTTCAGAAGTTGGATAAGTTGGATGTCTCCGAGCTGTTGAACGGAT
CTTGGATCGTTGTCGCTGGTGATTCCCAGGCGAGGTTCGTGGCGTTGTCGTTATTGGGCCTGGTGTTGGGCTCGGGGTCC
GAAGCTATGGGCTCGGTTAGAGAGGAGCTTTTCAAGAGGCATAGCGATTATAGTATTGTGGTTAAGGAGATTGGGATGAA
GGTTGACTTCGTGTGGGCGCCTTACGAGAAGGATCTTGACGATCTCGTCGTGTCTTACAAGAAGAAGAACAAGTTTCCAG
ACGTTGTGATCATGGGGAGTGGGTTATGGCATATGCTTCACGTCAACAACGCGTCAGATTTTGGTTTCCAGCTGAAGGAG
CTGAGGAGTCATGTTGAGTTGTTAGTCCCCGTGAGGACCAAGGGGGAAGAAGGAGGAGGAGGATCGGTTTCGGGGAGGTC
TATGCATATGTTTTGGATAGGGATGCCGGTTTTGATCAACGGGATGTTGAATACTGATGAGAAGAAGGAGAGGATGAGTG
ATACGGTGTGGCATGAGTACGATAGGTCGTTAGGGGAGAGTAAGATCTTGCGTCAGATGGGCGGGCCGCTTGTTTTGCTT
GATGTTCAGTCTTTTACTTGGAACTGTGGACCGCAGTGTACGCTTGATGGGATGCATTATGACTCTGCGGTGTATGATGC
TGCTGTTCATGTCATGCTCAACGCGTTGCTTATCGAATCTAATCAAACTTTGTGA