Details for Kale Locus Bo5g150150

Position : C5 ( 5`- 46203015 .. 46204685 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150150

Protein [Map View]
MQLFLLLLLLAALSPPATSHYSSSTSSPSSSSVSEWRPARATYYAATNPRDLVGGACGYGDLVKSGYGMSTVGLSETLFE
RGQICGACFELRCVDDLRWCIPGTSIIVTATNFCAPNYGFDPDGGGHCNPPNKHFVLPIEAFEKIAIWKAGNMPVQYRRI
NCRKEGSIRFTVDGGGIFISVLITNVAGSGDISAVKIKGSRTGWLPMGRNWGQNWHINADLKNQALSFEVTSSDKSTVTA
YNVAPRNWDYGQTFEGKQFETP*

DNA
ATGCAACTGTTTCTCCTCCTTCTCCTCCTCGCCGCACTATCTCCTCCGGCGACTTCCCACTACTCATCCTCAACCTCATC
TCCATCTTCCTCCTCCGTCTCCGAATGGCGTCCAGCTCGAGCCACCTACTACGCCGCCACGAATCCTAGAGACTTGGTGG
GCGGTGCGTGTGGATACGGAGATCTCGTCAAATCTGGATACGGTATGTCCACGGTTGGTCTGAGCGAGACTCTGTTTGAG
CGTGGTCAGATCTGTGGCGCTTGTTTCGAGCTCAGATGTGTCGATGATCTCCGTTGGTGTATCCCTGGAACTTCGATCAT
CGTCACCGCCACGAACTTCTGCGCTCCTAATTACGGGTTTGATCCCGACGGTGGTGGTCATTGTAACCCTCCGAACAAAC
ATTTCGTGTTGCCGATCGAAGCGTTTGAGAAGATCGCTATTTGGAAAGCTGGGAACATGCCCGTGCAGTATCGAAGGATA
AACTGTAGAAAGGAAGGGAGCATTAGGTTTACAGTAGACGGTGGAGGCATTTTCATTTCGGTTCTGATCACAAATGTTGC
CGGATCCGGTGATATATCCGCTGTGAAGATCAAAGGTTCGAGAACCGGGTGGTTACCAATGGGTCGTAACTGGGGACAGA
ACTGGCACATCAACGCCGATCTCAAGAACCAAGCTCTCTCGTTTGAAGTAACTTCTAGTGACAAATCAACCGTGACAGCT
TACAACGTCGCTCCTAGAAACTGGGATTACGGACAAACCTTCGAAGGCAAACAATTCGAGACTCCGTAA