Details for Kale Locus Bo5g150120

Position : C5 ( 5`- 46168860 .. 46170338 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150120

Protein [Map View]
MLLLVLVVGLICYHVYKSIKPPPPIPLPENVSEISPRVKLNDGRYLAYRELGFPKDKAKNKIIILHGFGSSKLVDLKITQ
EMIDEFEIYFLLFDRAGYGESDAHPSRTVKTDTYDIEELADKLQIGPKFHVLGMSLGAYPVYGCLKYIPHRLSGATLVVP
LLNFWWSSMPQSLLSAALKKLPIENQWTFRVAHYLPWLLYWWLTQKWFSPFSPNPRETMTERDIELADKHTKHSYIKESA
LRQGEYVSKHRDIIASFENWEFDPTELLNPFSDGNKGSVHMWCALEDKQILREALLYICDKLPWIKLRQVPEAGHLIIHE
KQHFEDIIKTACT*

DNA
ATGTTGCTTCTAGTTCTGGTTGTCGGTTTAATATGCTATCATGTCTACAAATCCATAAAACCACCGCCACCAATCCCGCT
GCCAGAGAATGTTTCTGAGATATCTCCAAGAGTTAAGCTCAATGATGGGAGATATTTAGCCTACAGAGAATTAGGGTTTC
CAAAAGATAAAGCCAAAAATAAAATAATCATTCTCCATGGTTTTGGAAGTTCAAAGTTAGTAGATTTAAAAATCACACAG
GAAATGATTGATGAATTCGAGATATACTTCTTGCTCTTCGATAGAGCTGGTTATGGAGAAAGCGATGCTCATCCATCACG
AACGGTAAAAACGGATACATACGATATCGAAGAACTCGCCGACAAATTGCAAATTGGTCCGAAGTTCCATGTCTTAGGAA
TGTCACTCGGGGCTTATCCAGTTTACGGCTGTCTCAAATACATCCCTCATAGGTTAAGTGGAGCAACGTTGGTGGTTCCG
TTACTTAATTTTTGGTGGAGTAGTATGCCTCAAAGCCTATTGAGTGCAGCGCTCAAGAAATTACCAATTGAGAACCAATG
GACATTTAGAGTTGCACACTACCTTCCGTGGTTGCTATATTGGTGGTTGACGCAGAAATGGTTTTCACCGTTTAGTCCGA
ATCCCAGAGAAACTATGACCGAGCGCGACATAGAACTCGCGGACAAGCACACAAAACACTCTTATATTAAGGAATCTGCT
CTACGACAAGGCGAATATGTGAGCAAGCACCGAGACATCATTGCGTCTTTCGAGAATTGGGAGTTTGATCCAACAGAATT
GCTCAATCCGTTTTCAGATGGTAACAAAGGGTCAGTTCACATGTGGTGTGCACTCGAAGACAAACAAATTTTGCGTGAGG
CTTTACTCTATATATGTGATAAGCTGCCATGGATAAAACTTCGTCAAGTTCCAGAAGCTGGACATCTTATTATCCATGAG
AAGCAGCATTTTGAAGATATTATCAAAACCGCTTGTACTTGA