Details for Kale Locus Bo5g150100

Position : C5 ( 5`- 46158967 .. 46162580 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150100

Protein [Map View]
MDYDGDGSPDNEHYTSVNAMSKEKRICHRHTPQQIQKLEAYFKECPHPNESQRQAFCDVLNLGIDQVKFWFQNKRTQSKA
QDERTSNMLLREENEKLRLENAAMIEVLKNVTCPPCGGPPFGRDDRESNLHKMRLENAFFKTERDSLAAANNKNQQTMLD
SLTSVQRQQTFEALTSYGMNPYNQPSSLESQTIQPQLLPQMDIPQLSETAATAVEELKRLFRTDESLWVMSSIDRTYVID
QESYEKFSHSIKHFRNLSARVESSKDITVVPIEATSLIDMFLDSEKWKMLFPTIVNEAKTIHTLGSELPINENCNVLQVI
WEQLHILSPLVPPREFMIVRCCQQIGEGLWIIADVSQDSQHIVNSDQASPSCYKRPSGCLIRSLPNAHTEVSIASNDLNM
SINPYKFIHYIFLFDVTEIFQVRWIEHVEVDHTTDTHKMYRELVSGSSGYGARRWIVTLERMCERMALSSILIMPATDWS
ETIPTVEGRRSVMKLGERMLKIFNEMLIMSGKVEFPQQSKCGVRISIRMNMEPGQLPGLVVSAASCLSIPLTPLQVFNCL
RSNDTRHQWDVLCRGNAITETARIFTGSSGTNCINLLQPTPPWDIGQNMVQEPHKKMMVLQECYMDALGGMIVYSPLDMA
TMSIAASGEVDPLKIPILPSGFTISSDNSEGTLLMLAFQILNSDENSKTRSVSEIAVDRVSRLISQTVQSIKLMLNCPPE
*

DNA
ATGGATTATGATGGTGATGGAAGCCCAGACAACGAACACTATACTTCAGTAAATGCCATGTCAAAAGAGAAGAGGATTTG
TCATCGTCACACTCCTCAACAGATTCAGAAGCTAGAAGCTTATTTCAAAGAATGTCCTCATCCAAACGAATCACAGAGAC
AAGCGTTTTGCGATGTGTTGAACCTCGGGATAGACCAAGTCAAATTTTGGTTTCAGAACAAAAGAACTCAAAGCAAAGCT
CAAGATGAGAGAACTTCAAACATGTTGCTTCGTGAAGAAAATGAAAAGCTCCGATTGGAGAATGCTGCGATGATCGAGGT
TTTAAAGAATGTGACTTGTCCACCTTGTGGCGGTCCTCCATTCGGCAGAGATGATCGCGAAAGTAATCTCCATAAGATGC
GTCTAGAAAACGCTTTCTTCAAAACGGAGCGTGACAGCTTGGCGGCAGCCAATAACAAGAATCAACAAACCATGTTGGAC
TCACTCACTTCTGTTCAAAGACAGCAAACCTTTGAAGCTCTCACCTCATATGGAATGAATCCATACAATCAACCTAGCTC
ATTAGAATCTCAAACCATCCAACCACAACTACTACCCCAAATGGATATACCGCAGCTGTCTGAAACTGCGGCAACTGCGG
TTGAAGAGCTTAAGCGGCTATTTCGTACCGATGAATCTCTTTGGGTTATGTCGTCTATTGATAGAACATATGTGATTGAT
CAAGAGAGCTATGAGAAGTTCTCGCACTCAATCAAACATTTCAGGAACTTGAGTGCTCGTGTCGAGTCTTCTAAAGATAT
CACGGTGGTTCCTATTGAGGCAACAAGCTTGATTGATATGTTCTTAGATTCGGAGAAATGGAAAATGCTTTTTCCAACGA
TCGTGAACGAGGCCAAGACGATTCATACGCTCGGATCCGAGCTTCCGATAAATGAAAATTGCAATGTCTTGCAAGTGATA
TGGGAGCAACTACACATATTGTCGCCACTAGTGCCACCAAGGGAGTTTATGATCGTTAGATGCTGCCAACAGATCGGTGA
AGGGCTCTGGATTATTGCTGATGTGTCACAAGACTCACAACACATCGTTAACTCTGACCAAGCCAGTCCGTCTTGTTATA
AACGTCCTTCTGGTTGTCTCATCCGATCCTTGCCCAATGCTCACACCGAGGTGTCTATTGCCTCGAACGATCTCAACATG
TCTATCAATCCGTACAAATTTATTCATTATATTTTCTTATTTGATGTTACTGAAATATTTCAGGTAAGGTGGATAGAGCA
TGTGGAAGTGGACCATACAACCGATACACATAAGATGTATCGAGAGCTTGTAAGTGGCAGTTCGGGCTATGGAGCTAGGC
GTTGGATCGTCACCCTTGAGAGAATGTGTGAGAGAATGGCTCTCTCCTCCATCCTAATCATGCCGGCTACTGACTGGAGT
GAAACTATACCGACAGTGGAAGGACGAAGGAGTGTGATGAAATTAGGGGAAAGAATGTTGAAGATCTTCAACGAAATGTT
GATCATGTCCGGGAAGGTTGAGTTCCCGCAGCAATCGAAATGTGGAGTCAGAATCTCGATCCGGATGAACATGGAACCCG
GTCAACTACCCGGTTTAGTTGTCAGTGCTGCATCTTGTCTCTCAATCCCTCTCACTCCTTTGCAAGTCTTCAACTGCCTG
AGAAGCAACGACACTCGTCACCAGTGGGACGTTCTTTGTCGTGGAAACGCAATCACTGAGACCGCTCGCATTTTCACCGG
ATCAAGTGGAACAAACTGCATCAACCTACTCCAGCCTACACCACCGTGGGATATTGGACAAAATATGGTACAAGAACCAC
ACAAGAAGATGATGGTGCTACAAGAGTGTTACATGGACGCATTAGGAGGCATGATAGTGTACTCTCCTCTTGACATGGCT
ACAATGAGTATCGCTGCATCTGGGGAAGTCGACCCTTTGAAAATTCCAATCCTTCCTTCTGGCTTCACCATCTCAAGCGA
CAACAGTGAGGGAACTTTACTCATGTTGGCTTTTCAGATCCTTAACTCTGATGAAAACAGTAAGACCAGAAGTGTGAGTG
AGATTGCAGTGGACAGAGTGAGTAGATTGATCAGCCAAACTGTTCAAAGCATCAAGCTCATGCTCAATTGTCCTCCTGAG
TGA