Details for Kale Locus Bo5g150090

Position : C5 ( 5`- 46156570 .. 46157519 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150090

Protein [Map View]
MVKARTVGVGMDYSPTSKSALRWTAENLLDDGDTIILIHVQPQNAEHTRKILFEETGSPLIPLEEFREVNFSKQYGLAYD
PEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLGPLKRMLLGSVSNHVVTNATCPVTVVKAN*

DNA
ATGGTTAAAGCACGTACGGTGGGTGTGGGAATGGATTACTCTCCAACGAGCAAATCGGCTCTTCGGTGGACGGCTGAGAA
TCTCCTTGACGATGGAGACACCATCATTTTGATTCATGTTCAACCCCAAAACGCTGAGCACACCCGCAAAATCCTCTTTG
AGGAAACCGGTTCACCTTTGATTCCCCTGGAAGAATTTAGAGAGGTTAATTTCTCTAAACAGTATGGACTTGCTTATGAT
CCGGAAGTTCTTGATGTTCTTGATACTCTCTCTAGGGCAAAGAAGGTGAAGGTGGTGGCAAAAGTGTATTGGGGAGATCC
AAGGGAGAAACTTTGCGATGCCGTCGAAAATCTAAAACTCGATTCTATTGTTCTTGGCAGTCGAGGCTTGGGTCCTCTCA
AAAGGATGTTGCTGGGTAGTGTGAGCAATCATGTGGTGACAAATGCAACATGTCCAGTCACGGTTGTTAAAGCCAATTAA