Details for Kale Locus Bo5g150070

Position : C5 ( 5`- 46150480 .. 46151004 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150070

Protein [Map View]
MGNYVSCALSKTTSSNSSSSSPAAKVILPDGEVRDINVPTKAAELMMEMPSHFLVDVKSLKIGRKLIPLAADDDLDVGGC
HVYVAFPMTRVASAANASDMARIFMAGKKRLRSCDNRKVSPEEEEDENARLVKGTKLNLEDIEDFSAVEFMHRISVSKSK
KPELETIVEENVSL*

DNA
ATGGGCAACTACGTTTCATGCGCTCTAAGCAAAACGACTTCATCTAATTCATCATCATCATCACCGGCGGCTAAAGTGAT
TCTCCCGGACGGTGAAGTACGTGACATCAACGTACCAACAAAAGCAGCCGAGCTCATGATGGAGATGCCAAGCCATTTTC
TCGTTGACGTCAAGTCCTTAAAAATAGGTCGTAAACTCATCCCTCTCGCAGCCGACGACGACCTAGACGTTGGAGGCTGC
CATGTATACGTCGCGTTCCCCATGACGCGTGTGGCTTCCGCAGCCAATGCATCCGACATGGCTCGGATCTTCATGGCCGG
CAAGAAACGTTTGAGAAGCTGTGACAATAGGAAAGTGTCTCCAGAGGAGGAGGAAGATGAAAACGCGAGGTTGGTTAAGG
GAACGAAGCTGAATCTTGAAGATATAGAAGATTTCTCGGCGGTGGAGTTTATGCATAGGATCTCTGTTTCCAAATCTAAG
AAGCCAGAGTTGGAGACAATTGTCGAAGAAAACGTGTCGTTGTAA