Details for Kale Locus Bo5g150030

Position : C5 ( 5`- 46131120 .. 46138211 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150030

Protein [Map View]
MTIVDMEIESADQVSPLPFARSYQVEALEKAMKRNTIVYLETGSGKTLIAIMLLRSYAYLFRKPSPCFSVFLVPQVVLVT
QQAEALKRHTDLKVGMYWGSMGVDFWDAPTWKQEVDTYEVLVMTPAILLSALRHSFLTLNMIKVLIFDECHHARGNHAYA
CILKEFYHKELKSATSVVPRIFGMTASPVKTKGENLDSYWKKIHELESLMNSKVALFSSCVLLVYTCESESVLARFVPFS
TPSFKLYQHMEIPSSTRAGIIAELEKLAKEHLFALSTLDLKSSTVNSIKKRLSKICSSITYCLDELGILMALKAAQSFSV
SQNDFVLWGQLEKFSETSIKKFCSNASQAILAYIPDGPYWSVANIERKLEPGLVTSKIVCLVESLLGYRSLEKIRCIIFV
ERVIAAMVLESFLNEILPTYNSWKTKYVAGNNSGLQSQTRKKQNETVEDFRKGLVNIIVSTSILEEGLDVQSCNLVVGFD
PASNICSFIQSQGRARMPNSDYLMMVESGDMGTRSRLKKYISGAKRMREDSLSHSLVPCQPLPDDSSGEVYRVDSTGAIV
TFSSSVSLIYFYCSRLPSDEYFKPTPRFDIDKDQGICILYLPKSCQVKEVKFQGNGNVLKQAVCLKACIKLHRAGALTDH
LVPDMVLKETVQQKLGKIHYDTEQPSYFPPELVSQFSALSQTTYHLYSIRMKSEFPGNLHFKDILLGTRVKLEDDIGNTC
FRLEDHLGTIAVTLSYVGAFDLAQDEILLCRRFQITLFRVLLDHSVENLVAALDGLHLRDGLALDYLLVPSTHEQKASLI
DWEVIRSVNFTSHKPWKRHVNCSAKDASCILHTKNGLFCTCVLQNALVYTPHNGYVYCTRGILSNLNANSVLTKRNSGDV
TYMEYYEKRHEIRLSFVDEPLLNGRHIFTMHNNLHMTMKKKEKEHDKEYVELPPELCHVILAPISVDMIYSYKFMPSVMH
RIESLLIALNLKKNIPKVNIPTIKVLEAITTKKCQDQFHLESLETLGDSFLKYAVCQHLFQEYHTHHEGLLSSIKDGMIS
NVTLCKFGCDQKIQGFIRNECFEPKGWMVPGQSSAAYALVNDHLSESRSMYIARRRNLKRKSVADVVEALIGAYLSEGGE
LAALTFMNWVGIKVDFTTTMIQREPSIQAEKLVNVSYMESLLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSV
LDYLITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSEFERLSSVQSSFGWESE
IAFPKVLGDVIESLAGAIHVDSGYDKEVVFACIKPLLGCMITPETVKLHPVRELTELCQKAQFELTKAKGFENGEAYFTV
EVRRTTEASITNIEPSRSSSIRERKASELQFSRNMYPRAASRLLELEESSKDTTNIKPSHSSNVSHEAFLHRFQSLTVVI
KFCSHSWTSALISELENFKNKIQISSKQMDDFAEMENEYNKDSSEAAKVQRNTDEILKTSAKLCQV*

DNA
ATGACGATTGTTGATATGGAGATTGAGAGCGCCGATCAAGTCTCTCCTCTACCATTTGCTAGAAGTTATCAAGTGGAGGC
GCTAGAGAAAGCAATGAAGCGGAACACGATTGTTTACTTGGAGACTGGCTCTGGCAAGACTCTTATCGCCATCATGCTTC
TCCGTAGCTACGCTTACCTTTTCCGCAAGCCTTCCCCTTGCTTCAGCGTCTTCTTGGTTCCTCAAGTTGTTCTCGTCACT
CAACAAGCTGAAGCGCTGAAGAGGCACACGGATCTGAAAGTGGGCATGTATTGGGGATCCATGGGGGTTGACTTTTGGGA
TGCTCCTACTTGGAAACAAGAAGTCGATACATATGAGGTTCTTGTGATGACACCTGCTATTTTGCTCAGTGCATTAAGAC
ATAGTTTTCTGACGTTGAACATGATCAAGGTTCTTATCTTTGATGAATGTCATCATGCTCGGGGTAATCACGCTTATGCT
TGTATCTTGAAGGAGTTCTATCACAAGGAGTTAAAGTCTGCAACTTCTGTCGTTCCTCGAATATTTGGGATGACTGCTTC
CCCTGTGAAAACAAAGGGTGAAAACTTGGATAGCTACTGGAAAAAGATTCATGAACTCGAATCTCTAATGAATTCAAAGG
TTGCTCTTTTCTCATCTTGTGTTCTTTTGGTCTATACATGTGAAAGTGAGTCTGTGCTGGCTCGGTTTGTACCCTTTTCT
ACTCCGAGTTTCAAGTTGTACCAGCACATGGAAATACCAAGCTCTACACGCGCAGGCATAATAGCGGAACTTGAAAAGCT
AGCCAAAGAGCATCTCTTTGCCCTTTCAACACTGGATCTCAAATCCTCCACTGTTAATTCTATAAAGAAGAGACTGTCAA
AGATATGTTCATCTATAACTTATTGTTTGGATGAACTTGGAATTTTGATGGCGCTGAAGGCTGCTCAGTCATTCTCAGTC
AGTCAGAACGACTTTGTCTTGTGGGGTCAACTAGAGAAGTTTAGCGAAACCTCTATAAAAAAGTTCTGTAGTAATGCTTC
ACAGGCCATTTTAGCTTACATACCTGATGGTCCTTACTGGAGTGTTGCTAACATAGAAAGAAAGTTGGAGCCAGGTCTCG
TAACATCAAAAATAGTCTGCCTTGTTGAATCTCTTCTTGGTTATAGGTCCTTGGAGAAGATACGGTGCATCATATTTGTG
GAACGGGTGATAGCAGCGATGGTTTTGGAATCCTTTTTGAATGAAATTCTTCCAACCTATAATAGTTGGAAAACTAAGTA
CGTTGCAGGAAACAACTCTGGCTTGCAAAGTCAAACCCGGAAGAAGCAGAATGAAACTGTGGAGGACTTTCGAAAAGGCT
TGGTAAACATCATCGTCTCAACATCTATTCTAGAGGAAGGTCTAGATGTTCAAAGTTGCAATCTGGTTGTTGGATTTGAC
CCTGCATCCAACATTTGCAGTTTCATACAATCTCAAGGGCGTGCTAGAATGCCTAACTCAGATTATTTGATGATGGTGGA
AAGTGGAGACATGGGCACACGATCTCGGTTAAAGAAATATATTTCTGGTGCGAAAAGAATGCGTGAAGATTCTTTGAGCC
ATTCTCTTGTTCCCTGTCAACCTCTTCCAGATGATTCATCCGGGGAGGTCTACCGTGTCGACAGCACAGGGGCTATTGTA
ACTTTTAGCTCAAGCGTCAGCTTAATATATTTCTACTGCTCAAGGCTTCCTTCAGATGAATACTTCAAACCAACTCCTAG
ATTCGATATAGACAAGGATCAGGGGATTTGCATCCTTTACCTTCCTAAGAGCTGTCAAGTAAAAGAAGTTAAATTTCAAG
GAAATGGAAACGTGTTAAAACAAGCTGTATGTCTTAAAGCTTGCATTAAGCTGCACCGAGCTGGTGCTCTAACTGATCAT
CTTGTCCCTGACATGGTTTTGAAGGAAACCGTCCAACAAAAACTCGGGAAAATCCACTACGACACTGAACAGCCAAGTTA
CTTCCCTCCAGAGCTAGTCTCCCAGTTTTCAGCACTATCGCAGACAACATACCACTTGTACTCAATAAGGATGAAGTCAG
AATTTCCAGGAAATCTTCATTTTAAGGATATTTTACTGGGAACCAGGGTTAAGCTTGAAGATGACATTGGGAACACATGC
TTCCGGTTAGAAGATCATCTTGGCACAATAGCTGTGACATTAAGTTATGTGGGAGCGTTTGACCTTGCACAAGATGAGAT
CCTTTTGTGTAGAAGGTTTCAGATAACTCTTTTCAGAGTACTATTGGATCATAGTGTGGAAAATTTGGTGGCGGCGTTGG
ATGGGTTGCATCTCAGAGACGGTCTAGCACTTGATTATCTACTAGTTCCATCCACTCATGAGCAAAAAGCATCTCTTATT
GATTGGGAGGTGATAAGATCCGTGAACTTTACTAGTCATAAACCTTGGAAAAGGCATGTGAATTGTTCTGCCAAGGATGC
TTCTTGCATTCTACATACAAAAAACGGGTTGTTTTGCACCTGTGTCTTACAAAATGCGTTGGTTTACACACCACATAATG
GATACGTCTACTGCACCAGAGGTATTCTCAGCAATTTAAACGCAAATTCTGTATTGACCAAGAGAAATTCTGGCGATGTG
ACCTACATGGAGTACTATGAGAAACGGCATGAGATTCGATTAAGTTTTGTGGATGAACCTCTTTTGAATGGGAGACACAT
TTTCACGATGCATAACAACCTTCACATGACCATGAAGAAAAAGGAGAAAGAGCATGACAAGGAGTATGTTGAACTACCTC
CTGAACTATGTCATGTCATATTGGCTCCAATATCAGTGGATATGATCTATTCATATAAATTCATGCCATCTGTTATGCAC
CGCATTGAATCTTTGCTTATAGCATTGAACCTTAAGAAGAACATCCCAAAAGTCAATATTCCAACCATCAAGGTTCTGGA
AGCTATCACAACGAAGAAGTGCCAAGACCAGTTCCACTTGGAATCACTAGAAACACTTGGCGACTCTTTTCTGAAATATG
CTGTTTGTCAGCATCTATTCCAAGAATATCATACTCATCACGAGGGTCTTCTCAGCTCAATAAAAGATGGAATGATTTCG
AATGTCACGCTCTGCAAATTTGGATGTGACCAAAAAATTCAGGGATTTATACGGAACGAGTGTTTCGAACCTAAAGGGTG
GATGGTTCCTGGCCAATCATCTGCAGCTTATGCTCTTGTGAATGATCATCTATCCGAATCTAGAAGCATGTACATTGCTA
GGAGGAGGAATTTGAAACGCAAGAGTGTGGCTGATGTTGTAGAAGCACTAATTGGTGCGTATCTTAGCGAGGGAGGTGAA
CTAGCAGCGCTAACGTTCATGAACTGGGTTGGTATAAAAGTCGATTTCACGACTACAATGATCCAAAGAGAGCCATCTAT
ACAAGCCGAGAAGCTTGTGAATGTAAGCTATATGGAGTCTCTGTTGAACTATAAGTTTAAGGATAAGTCTCTTCTAGTCG
AGGCATTGACTCATGGCTCATACATGATTCCTGAAATTCCAAGATGCTATCAGCGGTTGGAGTTCCTCGGCGACTCTGTG
TTGGATTATCTCATAACCAAGCATTTGTACGGCGAATATCCTAATCTTTCTCCTGGTCTACTAACCGACATGCGCTCTGC
TTCTGTGAACAATGAATGTTATGCTCAAGTAGCGGTGAAATCAAACCTGCACAAACACGTCCTCCATGCCTCTCATGATC
TCCACAAGCACATCTCCAGAACAGTTAGTGAGTTTGAACGGTTGTCGTCTGTGCAATCCAGTTTTGGATGGGAATCCGAA
ATAGCTTTCCCAAAGGTTCTTGGAGATGTGATAGAGTCTTTAGCTGGTGCGATACATGTTGACTCGGGTTACGACAAGGA
AGTAGTGTTTGCGTGTATAAAACCGCTTTTGGGATGTATGATAACTCCAGAGACTGTGAAGCTGCATCCTGTGAGAGAGT
TGACAGAACTTTGCCAGAAAGCTCAGTTCGAGTTGACTAAAGCTAAAGGCTTCGAGAATGGTGAAGCTTACTTCACGGTT
GAGGTTCGTCGAACTACTGAAGCATCCATAACAAACATTGAGCCAAGCCGGAGCAGCAGTATTCGAGAACGGAAAGCCAG
TGAGCTTCAGTTCTCAAGAAACATGTATCCGAGAGCAGCGTCTAGACTACTAGAACTCGAGGAATCTTCTAAAGACACAA
CAAACATTAAGCCAAGCCATAGCAGCAATGTGTCCCATGAAGCCTTCTTGCATCGTTTTCAGAGTCTGACAGTGGTGATA
AAGTTCTGTTCTCATTCTTGGACTTCTGCTTTGATTTCAGAGCTGGAGAATTTCAAGAACAAGATACAAATAAGCTCGAA
ACAGATGGATGACTTTGCTGAAATGGAGAACGAATATAATAAAGATTCATCAGAGGCAGCGAAAGTTCAGAGGAACACTG
ATGAAATATTAAAGACATCGGCAAAACTCTGTCAGGTGTAA