Details for Kale Locus Bo5g150020

Position : C5 ( 5`- 46122148 .. 46125026 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150020

Protein [Map View]
MEANGDDDELRKNTPLHRRRISLSSIHLLLLISLSTTTRVSASVDESGRRRVIEARSGQDLVWVVQLSDLHFSVHHPERA
IDFRNILGPALSLINPSLVLITGDLTDGKSKDLLTMKQNEQEWLEYESVMQDVIKTSGLNKTLFYDLRGNHDNFGVPSLG
SSVDFFSKYSINGKLGRKENVNTVTLETSERKHLFVGVDTTMSIGLRGPTNLFGHPTDELLTSLDSQLSQWDDDKPTKPV
TKISFGHFPLSFSALTHSKKSLRDVFLKHSVSAYLCGHLHSRFGKNLKRLHRSGGVSLSDNDLFQLNMRRSGGDESATNC
SFGASPDAEFWEWEMGDWRKNRAMRIVAIDRGHVSYLDLDFKSSESRKTIVLPTFPLDSRFMSTSLARHRYECQHMISSS
YDAIRAIVFSQSLVVDVVARVYDSSPGFNNLVMEAPMRKHGSTSGASFYSLPWNYRAFEDSLPDRYWLQIEVTDIKGRTT
LSELRPFSINGLSSRVSWTWNEFRVMGCQWAALYFPILWSVISCLLLAFFIPKCIIVVFKKQYTLKKFVAKKGLFTLVLW
ILQDLCRLPVVWFGYVAYLFYLVFFPWFSGEVFTDSGKRTYMTIMGWVVTSSGGGERKHEYVGEPDVMVLVIPHLVFVVI
PSLVIVCCLVAERELYKEHIRAVSGKKEDDHNDRGRKKRWQRRSVLFSKRRLVRKSLLLASLALYWKHFKNCWSLARAYE
MNVTHFPGYSLVVPLLLLYVIFKTHKAP*

DNA
ATGGAAGCGAACGGCGACGACGATGAGCTACGAAAGAACACACCTTTACACCGGAGAAGAATCTCGTTGAGTTCAATTCA
TCTTCTTCTGTTAATCTCCTTGAGCACGACGACGAGGGTCTCTGCTTCGGTAGACGAATCTGGAAGAAGAAGAGTGATCG
AAGCTAGAAGCGGACAAGACTTGGTTTGGGTGGTTCAGCTATCAGATCTCCATTTCAGCGTTCACCATCCCGAGAGAGCA
ATTGATTTCAGAAACATACTTGGTCCTGCTCTCTCCCTCATCAACCCTTCTCTCGTCCTAATCACCGGCGATCTCACAGA
TGGGAAGAGTAAAGACTTGTTAACAATGAAGCAAAACGAACAAGAGTGGTTAGAGTATGAGAGCGTGATGCAAGATGTTA
TCAAGACAAGTGGGTTGAATAAAACCTTATTCTATGATCTTAGAGGTAACCACGACAACTTTGGTGTCCCCTCTCTTGGT
TCGTCCGTTGATTTCTTCTCAAAGTATAGCATCAATGGGAAGTTAGGAAGGAAAGAGAATGTCAACACCGTCACTCTCGA
GACTAGTGAACGTAAACATCTCTTCGTTGGTGTTGACACCACAATGAGTATTGGACTACGCGGCCCAACGAACCTCTTCG
GCCACCCAACCGATGAGCTTTTAACCTCGCTCGACTCACAGTTATCGCAATGGGATGACGACAAGCCGACAAAGCCTGTA
ACAAAGATCTCATTCGGACATTTCCCTTTATCCTTCTCAGCTCTAACACATTCCAAAAAGAGCCTTAGGGACGTGTTCTT
GAAGCACTCCGTCTCCGCTTACCTCTGTGGACATCTGCACTCGAGGTTCGGCAAGAACCTCAAGAGACTCCACCGCTCCG
GCGGCGTCAGTTTATCGGATAACGACTTGTTCCAGCTGAACATGAGGCGGAGCGGCGGCGATGAAAGTGCTACGAACTGT
TCCTTCGGAGCCTCCCCGGATGCAGAGTTCTGGGAGTGGGAGATGGGAGACTGGAGAAAGAACAGGGCGATGCGGATCGT
GGCTATCGATAGAGGTCATGTCTCGTACCTCGATCTCGACTTCAAGTCGTCAGAGTCTCGGAAGACCATCGTGTTACCTA
CTTTTCCGTTAGATTCACGTTTCATGTCGACGTCGTTAGCACGCCACAGATACGAGTGTCAGCATATGATCTCTTCCTCC
TACGACGCGATCAGAGCCATTGTGTTTTCTCAATCTCTGGTTGTTGATGTTGTCGCTAGAGTCTATGACTCATCCCCTGG
ATTTAACAATCTAGTCATGGAAGCTCCTATGAGAAAACATGGTTCCACTTCTGGAGCATCTTTTTATTCGCTCCCGTGGA
ACTATAGAGCCTTTGAGGATTCTTTACCTGATAGGTATTGGCTTCAGATAGAAGTGACTGACATCAAAGGGAGAACGACT
TTATCAGAGCTGCGTCCGTTTTCAATCAACGGTCTAAGCTCTAGAGTGTCGTGGACGTGGAACGAGTTTCGTGTAATGGG
CTGCCAATGGGCCGCGTTGTACTTCCCCATTCTATGGTCTGTGATAAGCTGTTTGCTTCTTGCTTTCTTTATTCCGAAAT
GCATTATCGTTGTTTTCAAGAAGCAGTACACTCTCAAGAAGTTCGTCGCCAAGAAAGGACTATTCACGCTTGTGCTGTGG
ATTCTCCAAGACCTTTGTAGACTCCCTGTGGTTTGGTTCGGTTACGTGGCGTATTTGTTTTATCTCGTATTCTTCCCTTG
GTTCTCCGGCGAAGTGTTTACTGACTCCGGGAAGAGAACGTACATGACCATTATGGGATGGGTGGTGACTAGCTCAGGCG
GAGGAGAGAGGAAACATGAGTACGTTGGAGAGCCTGATGTGATGGTTCTAGTGATTCCGCATCTGGTTTTTGTCGTCATC
CCAAGTTTGGTGATTGTGTGTTGTTTGGTTGCTGAGAGAGAACTCTACAAAGAGCATATTAGAGCTGTATCTGGTAAGAA
GGAAGATGACCATAATGACCGGGGAAGGAAGAAGAGATGGCAGCGGCGGTCTGTGTTGTTCTCTAAGAGGAGATTGGTTC
GGAAGTCGCTCTTGCTGGCTTCATTGGCTCTCTACTGGAAGCATTTCAAGAATTGCTGGAGTCTAGCTAGAGCTTATGAG
ATGAATGTGACTCATTTTCCAGGTTACAGTCTTGTGGTTCCTTTGTTGCTACTTTATGTTATCTTCAAAACTCATAAAGC
TCCATGA