Details for Kale Locus Bo5g150000

Position : C5 ( 5`- 46117453 .. 46118882 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150000

Protein [Map View]
MERPHSPGTKSVDIGETLESLLRFTLRSHLDETVQSLDLDLPRDLCFHLLEEEDTDSTEEPARYKILARSLSECLTSEEH
SLSIDKDSNFEKYSKLFHGLGHDLVNMLKKVNFELHVQEPYFTQLKDGLKTTEGRCAVGDYMRISSGDFILFNKCLLLQV
QDVCYYTSFSEMLRVESLAKVLPGVETIEEGVGVYRNFYPEEKERMNGVVAIRVVKPVEQPYAALAGALSELKSTGIKAL
LDAYTSRVTSEDL*

DNA
ATGGAACGGCCACACTCGCCGGGAACGAAGTCGGTGGATATCGGAGAAACCTTAGAATCACTTTTGCGGTTTACTCTGCG
CTCTCATTTGGATGAAACAGTTCAAAGTCTCGACCTTGACCTGCCTCGAGATCTCTGCTTCCATCTCCTGGAGGAGGAAG
ATACAGATTCAACAGAAGAACCTGCGAGGTACAAGATTCTAGCAAGGTCTTTGTCTGAATGTCTTACTTCCGAGGAGCAT
AGTTTGTCCATTGATAAAGATTCAAACTTTGAGAAGTATAGCAAACTGTTTCATGGTTTGGGACATGACTTGGTAAATAT
GTTGAAGAAAGTAAACTTTGAGCTCCATGTCCAGGAGCCTTATTTCACACAACTGAAAGATGGTCTGAAAACTACTGAAG
GGAGATGTGCAGTAGGAGACTACATGAGGATAAGCTCAGGAGATTTTATTTTGTTCAATAAATGCTTACTGCTTCAAGTT
CAGGACGTTTGCTATTATACTTCATTCTCAGAAATGCTGAGAGTGGAGAGTCTTGCCAAAGTTCTTCCCGGAGTTGAGAC
TATAGAAGAAGGTGTGGGAGTTTACCGAAACTTTTACCCTGAAGAGAAGGAACGAATGAACGGTGTTGTCGCAATTCGTG
TTGTAAAACCAGTTGAGCAGCCGTATGCAGCTTTGGCAGGAGCATTGTCTGAACTCAAGTCCACTGGGATCAAAGCTTTG
TTGGATGCCTATACATCACGAGTTACATCTGAAGATCTTTGA