Details for Kale Locus Bo5g149980

Position : C5 ( 5`- 46112381 .. 46114586 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g149980

Protein [Map View]
MLTLLFSSLGLLLLLGLLLKFAFADGDFTLISKKHVKREAIEGKVVWITGASRGIGEVLAKQFASLGAKLILSARNEAEL
VRVKSELKGKYASEDVKVLPLDLASGEEGLKGAVEQAVSLFPGAGVDYLVHNAAYERPKSNAVDASEENLKTTFEVNVFG
TISLTKLVTPHMLKQGGGHFVVISSAAGKVPSPGQAIYAASKHALQGYFHSLRSEFFHKGIKVTVVCPGPIETSNGTGTS
TSEDKKSPEKRVSSERCAELTIIAASHNLKEAWISYQPVLLVMYLVQYMPFLGFWLMDKVGEKRVEVAEKKGNTYSWNLL
FQKKTKTN*

DNA
ATGCTGACTCTACTCTTCTCCTCTCTCGGACTCCTCCTTCTCCTCGGCCTTCTCCTCAAATTCGCATTCGCCGATGGGGA
CTTCACCCTGATTTCGAAGAAGCATGTGAAGCGCGAAGCCATAGAAGGCAAGGTGGTTTGGATCACAGGGGCTAGCCGTG
GAATTGGAGAAGTTCTTGCTAAACAGTTTGCAAGTTTAGGTGCCAAGCTTATTCTCTCTGCTAGGAACGAAGCTGAGTTG
GTTCGTGTTAAGAGTGAGCTCAAAGGTAAGTATGCATCAGAAGATGTCAAGGTTTTGCCTTTAGATCTAGCTAGCGGCGA
AGAGGGGCTCAAAGGTGCTGTAGAGCAAGCAGTGTCGCTTTTCCCTGGGGCTGGGGTTGATTATTTAGTTCACAACGCTG
CCTATGAACGTCCGAAATCAAATGCAGTGGATGCGAGTGAGGAAAATCTTAAGACTACATTCGAGGTTAATGTATTTGGG
ACAATATCTCTCACAAAGTTGGTAACTCCTCATATGCTGAAACAAGGTGGCGGTCATTTTGTAGTGATTAGCAGTGCAGC
AGGGAAGGTACCATCACCTGGTCAGGCTATATATGCTGCTTCAAAACATGCTCTGCAGGGCTACTTCCACAGCTTGCGTT
CTGAGTTCTTTCACAAGGGAATCAAGGTTACTGTTGTTTGTCCCGGTCCAATAGAGACCTCAAATGGTACAGGAACATCA
ACTTCGGAAGACAAGAAGTCTCCTGAGAAGCGCGTGTCATCTGAACGATGTGCAGAACTGACCATAATCGCCGCATCTCA
TAACTTAAAAGAAGCTTGGATTTCATATCAGCCAGTACTGCTCGTGATGTATCTAGTGCAGTACATGCCTTTCCTTGGCT
TCTGGCTCATGGACAAGGTTGGAGAGAAACGTGTGGAGGTTGCTGAGAAGAAAGGCAACACATACTCATGGAACTTGCTC
TTCCAGAAGAAGACTAAAACAAACTGA