Details for Kale Locus Bo5g149970

Position : C5 ( 5`- 46093754 .. 46102283 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g149970

Protein [Map View]
MGDSLEMLGSEASMETETGIKSDFCLEIDPPLRETVATAEDWRRALDKVVPAVVVLRTTACRAFDTESAGASYATGFIVD
KRRGIILTNRHVVKPGPVVAEATFVNREEIPIYPVYRDPVHDFGFFSYDPSAVQFLSYEEIPLAPEAASVGLEIRVVGND
SGEKVSILAGTIARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKTSSASAFFLPLQRVV
RALSFLQKSIDLCTDKPKAVHIPRGTLQMTFVHKGFDEIRRLGLRTGTEQVVRHASPPGETGMLVVDSVVPSGPADKQLE
SGDVLVRVNGTVLTQFLNLENLIDDGVGQIVELEIERGGQPLTVNVSVQDLHSITPDHFLEVSGAIIHPLSYQQARNFRF
PCGLAYVADPGYMLFRAGVPRHAIIKKVANEDISCLADLVSVLSKLSRGARVPLEYMSHTDRHRKKSVLVTIDRHEWYAP
PQLYTRNDSTGLWDGKPAIELAAVSPPIDINGLPISQNIPLCHHDTDPMHEFRGVTDTAATMGASSGDGYQNDFGSEAKK
QRVEDDSSDGTVANASLYGSELKSDDAMETDNTVLRDYEGATAFSANASLAERAIEPALVMFEVHVPPSCSLDGVHSQHF
FGTGIIIYHSSSMGLAVVDKNTVAISASDVMLSFAAFPVEIPGEVVFLHPVHNYALIAYNPSAMGPAAASAIRAAELLPE
PALQRGDSVYLVGLSRNLQATSRKSIVTNPCAALNIGSADSPRYRATNMEVIELDTDFGSSFSGALTDEQGRIRAIWGSF
STQIKYSSTTSEDHQFVRGIPVYAISQVLEKIITGGNGPALLINGIKRPMPLVRILEVELYPTLLSKARSFGLSDEWVQI
LVKKDPVRRQVLRVKGCLAGSKAENLLEQGDMVLAVDKMPVTCYNDIEAACLTLDKGTHSDENLNLTILRQGREMELVVG
TDKRDGNGTTRVINWCGCVVQDPHPAVRSLGFLPEEGHGVYVTRWCHGSPANRYGLYALQWIVEVNGKKTPDLNAFADAT
KELEHGQFVRIRTVHLNGKPRVLTLKQDLHYWPTWELRFDPETALWRRNILQALK*

DNA
ATGGGAGATTCGCTGGAGATGTTGGGATCAGAGGCATCAATGGAGACGGAAACTGGCATCAAATCCGACTTCTGCTTAGA
GATCGATCCTCCCTTGAGAGAAACCGTCGCCACCGCCGAAGACTGGCGCCGCGCTCTCGACAAAGTGGTTCCCGCCGTCG
TCGTGCTCCGCACAACGGCCTGCCGCGCTTTCGACACCGAATCGGCCGGTGCTAGCTACGCCACTGGGTTTATCGTCGAT
AAGAGGCGCGGGATCATTCTCACCAATCGCCACGTGGTTAAGCCAGGTCCAGTAGTTGCTGAGGCAACGTTTGTAAACCG
AGAAGAAATCCCGATCTATCCTGTGTATAGGGATCCGGTCCATGACTTTGGCTTCTTTTCTTATGATCCAAGTGCAGTAC
AGTTTCTGAGTTATGAAGAAATCCCCCTTGCCCCAGAGGCGGCTTCTGTTGGACTCGAGATTAGGGTTGTTGGCAATGAC
AGCGGAGAAAAGGTTTCTATACTGGCTGGTACTATTGCTCGGTTGGATAGGGATGCTCCACATTATAAAAAAGATGGTTA
TAACGACTTCAACACGTTTTACATGCAAGCAGCGTCAGGTACTAAAGGTGGATCAAGTGGTTCTCCAGTCATTGATTGGC
AAGGCAGGGCGGTAGCCTTGAATGCTGGAAGCAAGACCTCAAGTGCGTCAGCCTTCTTCCTACCACTTCAACGAGTTGTC
AGGGCGTTGAGTTTCCTTCAGAAAAGTATCGACTTGTGCACAGATAAGCCAAAAGCAGTTCATATTCCCCGTGGTACGCT
TCAGATGACATTTGTTCACAAAGGCTTCGACGAGATACGGCGACTTGGTCTCAGAACCGGAACTGAACAGGTGGTTCGGC
ATGCATCTCCACCTGGGGAAACCGGAATGCTTGTTGTCGACTCTGTTGTGCCAAGTGGCCCTGCTGATAAACAGTTAGAG
TCGGGAGATGTTCTTGTTCGTGTGAACGGCACAGTACTTACACAATTTCTAAACTTGGAGAATCTGATTGATGACGGTGT
TGGCCAGATAGTTGAATTAGAAATCGAAAGGGGTGGACAGCCACTAACTGTTAATGTGTCGGTTCAGGATCTACACTCAA
TCACTCCAGATCATTTCCTGGAAGTAAGTGGTGCTATAATTCATCCGTTGTCTTATCAGCAGGCTCGTAACTTTCGTTTT
CCTTGTGGCTTGGCGTACGTCGCGGATCCTGGATACATGCTGTTTAGAGCTGGGGTCCCACGACATGCTATCATAAAGAA
GGTTGCTAACGAGGATATTTCATGTCTAGCGGATTTAGTATCCGTCCTTTCAAAGCTCTCTAGGGGTGCTCGTGTTCCCT
TGGAATATATGTCTCACACCGATCGTCATCGCAAGAAGTCTGTGTTAGTCACAATCGACCGTCATGAATGGTACGCTCCT
CCACAGTTGTATACCCGTAATGACAGTACTGGTTTATGGGATGGGAAACCTGCTATCGAACTTGCTGCTGTTTCACCACC
TATTGATATTAATGGTTTGCCTATAAGCCAAAATATTCCTCTCTGCCATCACGATACAGATCCCATGCATGAATTTCGTG
GGGTTACTGATACTGCGGCTACTATGGGAGCCTCTAGTGGCGATGGTTATCAGAATGATTTTGGCTCAGAAGCAAAGAAA
CAAAGAGTGGAAGATGATTCTTCAGATGGAACTGTTGCAAACGCTTCCTTATATGGGAGTGAATTAAAATCTGATGATGC
AATGGAGACAGATAATACGGTATTAAGAGACTACGAAGGTGCAACAGCATTTTCTGCTAATGCTTCATTGGCTGAACGTG
CTATTGAGCCTGCTCTTGTCATGTTTGAGGTTCATGTGCCACCATCGTGCAGTCTTGATGGTGTACATTCCCAACATTTC
TTTGGTACCGGCATCATTATTTATCATTCTTCGAGCATGGGACTTGCTGTGGTGGACAAAAACACTGTTGCCATTTCTGC
ATCTGATGTTATGTTGTCCTTTGCTGCTTTTCCAGTCGAGATTCCTGGAGAGGTGGTATTTCTTCATCCTGTTCACAACT
ATGCTCTGATAGCCTATAATCCATCAGCAATGGGTCCTGCCGCTGCTTCAGCCATTCGTGCAGCTGAGCTACTACCTGAA
CCTGCACTGCAACGTGGAGATTCGGTCTATCTTGTTGGATTGAGTAGAAATCTTCAAGCCACGTCAAGAAAATCTATTGT
AACCAATCCATGTGCAGCGTTAAACATTGGGTCTGCTGATTCTCCCCGCTATAGAGCTACTAATATGGAAGTAATCGAGC
TTGATACTGATTTTGGTAGCTCATTTTCAGGAGCGCTGACTGATGAGCAGGGGAGGATTCGGGCCATTTGGGGAAGCTTT
TCGACTCAGATTAAATATAGTTCCACTACGTCAGAAGACCATCAGTTTGTCAGAGGTATCCCGGTATATGCGATCAGTCA
AGTCCTTGAAAAAATCATAACCGGTGGAAATGGACCAGCTCTTCTCATAAATGGTATCAAAAGGCCAATGCCACTTGTTC
GAATTTTGGAAGTTGAGTTGTATCCTACTTTGCTCTCAAAAGCCCGGAGTTTTGGTCTGAGTGATGAATGGGTCCAAATC
CTAGTCAAGAAGGATCCTGTTAGACGACAAGTTCTACGTGTTAAAGGCTGCCTGGCAGGATCAAAAGCTGAAAATCTTCT
AGAACAAGGCGACATGGTTCTGGCAGTGGATAAGATGCCAGTTACATGCTACAATGACATTGAAGCTGCTTGCCTAACAT
TGGATAAGGGTACCCACAGCGATGAGAATCTCAATCTAACAATCCTTCGACAGGGCCGAGAAATGGAGCTTGTAGTTGGA
ACTGATAAAAGAGATGGAAATGGTACTACAAGAGTGATAAACTGGTGCGGGTGTGTTGTTCAAGATCCTCATCCCGCGGT
TCGCTCTCTTGGATTCCTTCCTGAGGAAGGTCATGGTGTCTATGTTACAAGATGGTGTCACGGGAGTCCCGCAAACCGAT
ATGGCCTGTATGCACTTCAATGGATCGTGGAAGTTAACGGGAAGAAGACTCCTGATCTAAACGCATTTGCAGATGCCACC
AAGGAGCTAGAACACGGGCAGTTTGTGCGTATAAGGACCGTTCATCTTAACGGCAAGCCACGAGTGTTGACTCTAAAACA
AGATCTCCATTATTGGCCAACTTGGGAGCTGAGGTTCGACCCAGAGACTGCTCTTTGGCGGAGAAACATATTGCAAGCCT
TGAAATAA