Details for Kale Locus Bo5g149940

Position : C5 ( 5`- 46089708 .. 46090814 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g149940

Protein [Map View]
ANIIYKYTLRLLPPLRLSHRSQAATTLRLRELHRRLSRKAEMEDAASPNSGSDLNLGGNRGRSIEECQGMIQRSFRNPIV
KFLMGQMEKSGCRVGDNFVKAVVCTGPVAGGYTKGRGITVCSNYLTIQDEVNQVVIHELIHAYDECRAKNLDWTNCAHHA
CSEIRAGHLSGDCHFKRELLRGFIKLRGHEQECIKRRVLKSLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP*

DNA
GCTAATATAATTTACAAATATACCCTTCGTCTCCTTCCTCCTCTCCGTCTGTCCCATCGATCTCAAGCCGCCACGACTCT
CCGCCTCCGAGAACTCCACCGCCGATTAAGCAGAAAAGCAGAAATGGAAGATGCAGCCTCTCCTAATTCAGGTTCCGATT
TGAACCTCGGAGGGAACCGCGGTAGATCCATCGAAGAATGCCAGGGCATGATTCAACGAAGCTTTCGAAATCCGATCGTG
AAGTTTCTGATGGGGCAGATGGAGAAGTCTGGGTGCAGAGTTGGTGATAACTTCGTCAAGGCGGTTGTGTGTACTGGTCC
TGTAGCTGGCGGCTACACTAAAGGCAGAGGGATCACTGTGTGCAGTAACTATCTGACTATTCAAGATGAAGTGAACCAAG
TGGTTATACATGAGTTGATCCATGCTTATGACGAGTGCCGCGCCAAGAATCTGGATTGGACTAATTGTGCTCACCATGCT
TGCAGCGAGATACGTGCAGGTCATCTAAGTGGAGATTGCCATTTCAAGAGAGAACTTTTGAGGGGTTTCATTAAATTAAG
AGGGCATGAACAAGAATGTATAAAAAGAAGAGTGCTGAAATCGCTTCGTGGCAACCCGTATTGCTCTGAAGTAGCAGCGA
AAGATGCTATGGAAGCAGTGTGGGATACTTGTTACAATGATACTAAGCCTTTTGACAGAGCTCCTTGA