Details for Kale Locus Bo5g149930

Position : C5 ( 5`- 46085511 .. 46088060 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g149930

Protein [Map View]
MDLAGATSTVDSSSSSSSVSSTATSHDCDSPRGGDVDHELLRTTSVSVSVSLSSSSSASIQRVLSLIRSEDPDSRLFAAK
EIRRLTKTSHRCRRHFSQAVEPLVSMLRFESPESHHEAALLALLNLAVKDEKNKVSIIEAGALEPIINFLQCNSTTLQEY
ASASLLTLSASATNKPIIGANGVIPLLVKVIQHGSPQAKVDAVMALSNLSTLSTNLCMIIATKPLLPILSLLKSSKKSSK
TSEKCCSLIESLIVSGEEARTGLVSYEGGVFAVVEVLENGSLQAREHSVGVLLTLCQSDRSKYREPILREGVIPGLLELT
VQGTSKSRTKAQRLLSLLRNSKSPRSEVQPDTIENIVSSLISHIDGDDQSGKAKKMLAEMVQVSMEKSLRHLQERASTLV
RP*

DNA
ATGGACCTCGCCGGAGCAACCTCCACCGTTGATTCTTCTTCTTCCTCTTCCTCCGTATCATCAACCGCTACGAGCCACGA
TTGCGACTCGCCACGTGGCGGAGATGTAGACCACGAATTGCTCCGCACCACGTCCGTTTCCGTTTCCGTCTCCCTTTCTT
CGTCGTCTTCCGCCTCAATCCAGCGAGTTCTCAGCTTAATCCGATCGGAGGATCCCGACTCGAGGCTGTTCGCGGCCAAA
GAGATCCGTCGGCTGACCAAGACGTCGCACAGATGCCGCCGACACTTTTCCCAGGCCGTCGAGCCGCTCGTTTCCATGCT
CCGATTCGAATCGCCCGAGTCGCACCACGAGGCGGCTCTCCTCGCTCTCCTCAACCTCGCCGTCAAAGACGAGAAGAACA
AGGTGAGCATTATTGAAGCAGGTGCATTAGAGCCAATCATCAACTTCTTGCAATGTAATAGCACAACACTTCAAGAATAT
GCCTCTGCGTCTTTGCTCACACTCTCAGCCTCCGCTACCAACAAACCCATCATTGGAGCTAATGGAGTGATTCCTCTATT
AGTGAAAGTCATTCAACATGGAAGCCCACAAGCTAAAGTCGATGCAGTCATGGCACTTTCCAACCTCTCTACGCTCTCCA
CCAACCTGTGCATGATCATAGCCACCAAACCACTCTTACCGATACTGAGTCTTCTCAAATCAAGTAAAAAATCATCGAAA
ACATCTGAGAAATGCTGTTCCCTCATAGAGTCCTTAATAGTTTCTGGCGAGGAGGCGAGAACAGGTTTAGTTTCATACGA
AGGAGGAGTTTTTGCGGTGGTGGAGGTTCTTGAAAACGGGTCACTACAAGCTAGGGAACACTCGGTTGGCGTTCTCTTAA
CACTGTGCCAAAGCGATAGGAGTAAATACAGAGAGCCGATTCTCAGAGAAGGTGTAATACCGGGACTGCTTGAGCTCACG
GTTCAAGGAACATCGAAGTCTCGGACCAAAGCTCAAAGACTTCTCTCTTTACTAAGGAACTCAAAAAGTCCAAGATCAGA
GGTTCAACCCGATACAATAGAGAACATAGTGTCGAGCTTGATCTCTCACATAGACGGAGATGATCAGTCCGGTAAGGCGA
AGAAGATGCTAGCTGAAATGGTGCAAGTAAGCATGGAGAAGAGCTTGAGACATCTACAAGAACGTGCTTCCACTCTTGTC
CGTCCCTAA