Details for Kale Locus Bo5g149860

Position : C5 ( 5`- 46065380 .. 46066937 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g149860

Protein [Map View]
MDYQVSLPPSTTTCLSFKVQRRQPELVTPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYRPNLTSNLDPVQVVRRALAQT
LVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADADVTLAKLEEADALLPPFPCLEELLFDVEGSSELLNTPLLLVQVTR
LKCSGFIFALRFNHTMTDGAGLSLFLKSLCELACGLHAPSVPPVWERESLIASASARVTHTHREYDDKVEPEAVVVGDFL
VSRSFFFGPEEISAVRGLLPADLHNTTFEVMTSFLWRCRTIALSPDPNTEMRMTCIVNSRSKLSNPPIPSGYYGNVFAIP
VAIATAKDLMEKPLEFPLRLIQEAKKSVTEDYIRSMTALMATRGRPMFVAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGT
AKAGIAVFPGVSFYVPFKNRKGVSGTVVAISLPVQAMEKFVKELDGVLHVT*

DNA
ATGGACTATCAAGTATCTTTGCCACCATCCACCACCACATGTCTCTCCTTTAAGGTGCAACGCCGGCAGCCTGAGCTTGT
CACTCCGGCTAAGCCAACGCCACGAGAGCTCAAACCTCTCTCCGACATAGACGACCAGCAAGGACTGAGATTTCAAATTC
CTGTTATCTTTTTCTATAGACCTAACCTTACTAGTAATCTTGATCCGGTTCAAGTGGTCAGGAGAGCTCTGGCTCAGACG
CTGGTTTACTATTACCCGTTCGCTGGTAGGCTCCGGGAAGGTCTTAACCGAAAACTTTCGGTGGACTGTACCGGAGAAGG
CGTTTTGTTCATTGAAGCAGACGCTGACGTTACGTTGGCTAAGTTGGAAGAAGCTGATGCTCTTCTTCCCCCTTTCCCTT
GCTTAGAAGAGCTTCTCTTTGACGTAGAAGGTTCCAGCGAGCTTCTTAACACTCCTTTGCTTCTCGTTCAGGTCACACGT
CTCAAGTGTAGCGGATTCATCTTCGCCCTCCGTTTCAACCACACCATGACTGATGGAGCCGGTCTGTCCCTCTTTCTGAA
ATCACTATGCGAGTTGGCATGTGGGTTACACGCGCCGTCGGTTCCACCAGTGTGGGAACGAGAGTCCCTGATTGCGAGTG
CATCTGCGCGTGTGACACATACGCACCGCGAGTATGATGATAAAGTGGAACCTGAAGCAGTTGTTGTTGGAGACTTTTTA
GTTAGTAGGTCTTTCTTTTTTGGTCCGGAGGAGATTTCCGCTGTACGGGGACTCCTCCCGGCCGATCTCCACAACACCAC
TTTTGAAGTGATGACATCGTTTTTGTGGCGTTGTCGGACGATTGCACTGAGTCCTGACCCCAACACCGAGATGCGAATGA
CATGCATCGTCAATTCTCGTTCCAAACTTAGCAACCCGCCCATACCATCCGGTTACTACGGTAACGTTTTTGCCATCCCT
GTGGCGATAGCTACCGCAAAAGATCTGATGGAGAAACCGCTCGAGTTTCCTCTGAGGTTGATACAAGAGGCAAAGAAGAG
CGTGACAGAGGACTACATACGGTCGATGACGGCATTAATGGCAACTAGAGGGAGGCCTATGTTTGTGGCAGCTGGAAACT
ATATAGTGTCGGATTTGAGACATTTTGATTTAGGAAAAGTTGATTTCGGGCCGTGGGGTAAACCTGTGTACGGTGGAACC
GCTAAGGCCGGTATCGCAGTGTTTCCAGGAGTGAGCTTCTACGTGCCATTTAAGAATAGAAAAGGTGTGAGCGGAACCGT
TGTGGCAATTAGCTTGCCGGTACAAGCGATGGAGAAGTTCGTAAAAGAGCTTGATGGTGTGTTACATGTGACCTAA