Details for Kale Locus Bo5g149850

Position : C5 ( 5`- 46062403 .. 46064124 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g149850

Protein [Map View]
MSDGYSKKTMTRNSKPPDLELYVKGVPFHLHNETLAKKSAKVTTLLECNKIDELRWILKDIDVDPTTFFLVVSFCYGYKI
HLSSENILSVLCTAYYLEMNDDHSSNNLLNKAVTFLEQRVLMSWNETVKALSVCSDKILDKIGDVGLTEVFLDSLLEKAL
KDPSLLEDLTTLPLRLYEPLIQEASKHNVSVENLVSSVYNYAKRYVFEKDSGDESVSRNKRQVLEAVERLLPHQRGAISC
GFLFKSLKESMFLDAFSECRKGFEDRISKQLDMATSKDLMILLPNKVGGGAYDTNLLKTILKSFYSNYNVSDVSRFVSVA
RMLEEFLLDAAASGDGLSIETFKAFGEITVAASCDVLRYSDGIYRAVDVFLERHRDDLTETEKMEACRVLDCRKLSPEAC
EHASTNEKLPLRIVVQVLFFAQKQIQDKVAREMESVEEKDDDDDIEDINKKLLRIDIESDYSEKREIENLECVVHCVKEK
KEERKISVWREVKRKFGCMTSLTVDACNCHIKKRKKTYHHYK*

DNA
ATGTCGGATGGATATTCGAAGAAAACTATGACCCGAAACTCAAAGCCACCAGATCTTGAACTCTACGTGAAAGGAGTCCC
ATTTCATCTTCACAATGAAACTTTGGCTAAGAAGTCTGCCAAAGTGACAACACTACTCGAGTGTAATAAGATCGATGAAC
TGCGGTGGATCCTCAAAGACATCGACGTGGACCCGACAACCTTCTTCCTCGTGGTTAGCTTCTGCTATGGCTACAAGATC
CATTTATCATCTGAAAACATCCTCTCTGTTCTCTGCACCGCTTATTACCTAGAGATGAACGATGATCACAGCTCTAATAA
CTTGCTGAACAAGGCAGTAACGTTCTTGGAACAACGAGTTCTTATGAGCTGGAACGAGACTGTGAAAGCTCTTAGCGTCT
GCAGCGACAAGATTCTTGACAAGATAGGTGATGTTGGACTCACTGAAGTCTTCTTAGACTCTCTTCTCGAAAAGGCTCTC
AAAGATCCTAGTTTACTCGAAGATCTTACTACGTTACCTCTTAGGTTATATGAACCATTGATCCAGGAAGCTAGTAAGCA
CAATGTCTCGGTCGAAAACCTCGTGTCATCGGTCTACAACTACGCTAAAAGATACGTTTTCGAGAAAGATTCAGGAGATG
AAAGTGTTTCAAGAAACAAGAGACAAGTTCTTGAAGCTGTTGAGAGGCTTTTGCCTCACCAAAGAGGAGCTATCTCCTGT
GGATTCTTGTTCAAATCTCTTAAAGAATCGATGTTTCTCGATGCTTTCTCTGAGTGTCGAAAAGGGTTTGAAGATAGGAT
AAGCAAACAGCTCGACATGGCCACATCAAAAGATCTTATGATTCTATTACCAAACAAAGTGGGAGGAGGAGCTTATGACA
CCAACCTCTTGAAAACCATTCTCAAGAGCTTCTACAGTAACTACAACGTCTCTGACGTTTCGAGGTTTGTGAGCGTAGCA
AGAATGCTTGAAGAGTTTCTATTGGATGCTGCAGCGAGTGGTGATGGTTTAAGTATAGAAACGTTTAAGGCGTTTGGAGA
AATAACGGTTGCTGCGTCTTGCGATGTTTTGAGATACTCTGATGGAATCTACAGAGCGGTTGATGTGTTCTTGGAGAGGC
ATAGAGATGATCTGACTGAAACTGAGAAGATGGAAGCTTGTAGAGTTCTTGACTGTAGGAAGCTTTCGCCTGAGGCTTGT
GAGCATGCTTCGACGAATGAGAAGCTTCCGTTGAGGATTGTTGTGCAAGTTTTGTTCTTTGCTCAGAAGCAGATTCAGGA
TAAGGTGGCTAGAGAAATGGAAAGTGTAGAGGAGAAAGATGATGATGATGACATTGAGGATATAAATAAAAAGTTGCTGA
GGATTGACATTGAATCTGATTACAGTGAGAAAAGAGAGATTGAGAATCTTGAATGTGTTGTTCATTGCGTGAAGGAGAAG
AAAGAAGAGAGGAAGATAAGTGTGTGGAGAGAAGTGAAGAGGAAGTTTGGTTGTATGACTTCTTTGACTGTGGATGCTTG
CAATTGTCACATCAAGAAGAGGAAGAAGACTTATCATCACTACAAATAA