Details for Kale Locus Bo5g148830

Position : C5 ( 5`- 46034944 .. 46037601 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148830

Protein [Map View]
MVPSSASISKALSSSSSSTLKDLRRIHALVISLGLERSSDFFSGKLIDKYSHLKDPRSSLSVFKRVSPAENVYLWNSIIR
ALSRNGLFSEALEFYGKLREANVSPDRYTFPPVVKACAGVFDKEIGDSVYNQIIELGFESDLYVGNAVVDMYSRMGVLCR
ARQVFDEMPVRDLVSWNSLISGFSSHGYHEEAVELYRELRRSSWIMPDSFTVTSVLYAFGNLLAVKEGEGLHGFVMKSGV
SSVVVVNNGLLSMYLKLRRVTDARRVFDEMVVRDSVSYNTMICGCFNLDMYEESVRLFLENLDQFKADILTVSSILRACG
HLRDLSLAKYVHEYMMRGGFSVGATVGNILIDVYAKCGDVIAARDVFKGMECKDTVSWNSLISGYIQSGDLLEGVKLFKM
MMMMEGQADHVTYLMLLSVSTRLSDLKFGRGLHCSVTKSGFYSDVSVSNALIDMYAKCGEEGDSLQIFNSMETRDTVTWN
MVISACVRSGDFASVLQVTTQMRNSGVVPDMATFLVTLPMCASLAGKRLGKEIHCCLLRFGYESELRIGNALIEMYSKCG
CLKSSLKVFEHMSRRDVVTWTGMIYAYGMYGEGEKALAAFADMEKEAGVVPDNVAFIAIIYACSHSGLVEQGLACFEKMK
TQYKIEPVMEHYACVVDLLSRSQKISKAEEFIQAMPVKPDASVWASLLRACRTSGDMETAERVSKKIVELNPDDPGYSIL
ASNAYAALRKWDKVSLIRKSLKDKERKKNPGYSWIEVSKKVYLFRAGDVSAPQFEAIQESLEMLYSLMAKEGYVPDPREV
SQNLEEEEEKRRLVCGHSERLAIAFGLLNTEPGTPLQVMKNLRVCGDCHEVTKLISKIVGREILVRDANRFHLFKDGACS
CNDRW*

DNA
ATGGTACCGTCATCAGCTTCCATCTCGAAAGCTCTTTCATCATCATCATCATCCACCCTCAAAGACCTCCGCCGAATCCA
CGCCCTCGTCATCTCTCTAGGCCTCGAACGCTCCTCCGACTTCTTCTCCGGCAAGCTCATCGACAAATACTCCCATCTCA
AAGATCCCCGCTCCTCCCTCTCCGTCTTCAAACGAGTCTCTCCCGCGGAGAATGTCTACCTCTGGAACTCGATCATCAGA
GCGCTTTCTCGCAACGGTTTGTTCTCCGAAGCACTCGAGTTCTACGGGAAGCTACGCGAGGCCAACGTTTCTCCCGATAG
GTACACGTTCCCTCCCGTCGTCAAAGCGTGCGCGGGGGTATTCGATAAGGAGATCGGAGATTCGGTTTATAATCAGATAA
TCGAATTGGGTTTTGAGTCTGATTTGTACGTGGGGAATGCAGTTGTTGATATGTACTCGAGGATGGGGGTTTTGTGTAGA
GCGCGGCAGGTGTTCGACGAAATGCCTGTGAGAGATTTAGTTTCTTGGAACAGTTTGATCTCCGGGTTTAGCTCTCACGG
TTATCACGAGGAAGCTGTGGAGCTTTATCGTGAGCTGCGAAGAAGCTCTTGGATTATGCCGGATTCGTTTACTGTGACGA
GTGTTCTGTATGCGTTTGGGAATCTGCTGGCTGTCAAAGAAGGAGAAGGACTTCACGGTTTTGTTATGAAGTCAGGTGTT
AGCTCTGTTGTGGTGGTTAACAATGGATTACTCTCAATGTACTTGAAGCTAAGGAGAGTAACGGATGCGAGGCGAGTTTT
CGATGAGATGGTTGTTAGAGACTCAGTCAGTTACAATACTATGATCTGTGGGTGTTTCAACTTAGATATGTATGAAGAGT
CCGTGCGGTTGTTTTTGGAGAATCTTGATCAGTTCAAGGCGGATATCTTAACGGTTAGCTCTATTCTCCGTGCCTGTGGA
CACTTAAGGGACTTAAGCTTAGCAAAGTACGTTCATGAGTACATGATGAGAGGTGGATTTTCGGTTGGAGCTACTGTGGG
GAACATCTTGATCGATGTGTATGCAAAGTGCGGTGATGTGATCGCGGCAAGAGATGTGTTCAAGGGGATGGAGTGTAAGG
ATACTGTTTCATGGAACTCGTTAATCAGTGGGTATATACAAAGTGGAGATCTTTTGGAAGGTGTGAAACTCTTTAAGATG
ATGATGATGATGGAAGGGCAAGCGGATCATGTCACTTACTTGATGCTTTTATCTGTCTCCACACGTTTATCAGACTTGAA
ATTTGGGAGAGGGCTACACTGTAGCGTGACAAAGTCTGGTTTTTATTCCGATGTTTCTGTTAGTAATGCTCTGATTGATA
TGTATGCTAAGTGCGGGGAAGAAGGAGATTCTCTGCAGATATTTAATAGCATGGAAACTAGAGATACAGTAACATGGAAC
ATGGTTATTTCAGCGTGTGTTCGTTCTGGAGACTTCGCAAGTGTTTTGCAGGTAACTACACAGATGAGGAACAGCGGTGT
GGTGCCTGATATGGCTACTTTCTTAGTTACATTGCCTATGTGTGCTTCACTTGCTGGTAAACGACTAGGCAAGGAGATCC
ACTGTTGTCTTTTAAGGTTTGGGTATGAATCGGAGTTGCGTATAGGGAATGCACTGATTGAAATGTACTCAAAATGTGGT
TGTTTAAAGAGCTCCTTAAAAGTCTTTGAGCATATGAGTAGAAGAGATGTTGTGACATGGACAGGGATGATCTACGCGTA
TGGAATGTACGGCGAAGGTGAGAAAGCTCTTGCAGCTTTCGCAGACATGGAAAAAGAAGCCGGTGTTGTTCCGGATAATG
TTGCCTTCATTGCCATCATCTATGCTTGCAGCCACTCTGGTTTGGTGGAACAAGGCTTGGCTTGCTTCGAGAAGATGAAA
ACTCAGTACAAGATCGAACCGGTGATGGAACACTACGCTTGTGTGGTGGATTTGTTGTCAAGGTCTCAAAAGATTTCGAA
AGCCGAGGAGTTTATTCAAGCGATGCCGGTAAAACCTGATGCTAGTGTATGGGCATCTCTGCTAAGAGCTTGTAGAACAA
GCGGGGACATGGAGACTGCGGAAAGAGTTTCTAAGAAGATCGTTGAACTGAACCCGGATGATCCAGGCTACTCTATTCTA
GCATCAAATGCGTATGCAGCGTTGAGAAAGTGGGACAAAGTGAGCCTAATCCGCAAATCCTTGAAAGACAAAGAGAGAAA
GAAGAACCCTGGATATAGCTGGATTGAAGTGAGTAAGAAAGTTTATCTGTTCCGCGCAGGAGATGTTTCAGCTCCTCAGT
TCGAAGCCATACAGGAGTCATTGGAGATGCTATACAGCCTGATGGCTAAAGAAGGGTATGTTCCTGATCCACGGGAAGTG
TCGCAGAATCTAGAGGAAGAGGAAGAGAAGAGACGTTTAGTATGTGGTCACAGCGAGAGGCTAGCGATTGCGTTTGGACT
GTTGAACACAGAACCAGGGACTCCATTGCAAGTGATGAAAAACCTTCGTGTCTGTGGTGATTGTCATGAAGTCACGAAGC
TGATATCGAAGATAGTAGGGCGTGAGATATTAGTGAGGGATGCTAATCGGTTCCATCTCTTCAAAGACGGAGCTTGTAGC
TGCAATGATCGGTGGTGA