Details for Kale Locus Bo5g148810

Position : C5 ( 5`- 46031838 .. 46032476 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148810

Protein [Map View]
MTLHGAVIQKLLNTGSHLGRRAAEHHFKQYAYGTRNGMTIIDSDKTLICLRSAASFVANLASARGNIFFVNTNPLFDEIV
ELTSRRIQGDAYNHNRSTNLWKMGGFLTNSYSPKKFRSRHKKLCFGPTTMPDCVVVFDAERKSSVVLEAAKLQIPVVAIV
DPNVPLEFFEKITYPVPARDSVKFVYLFCNVITKCFVAEQMKMGIKDGDLAA*

DNA
ATGACGCTCCACGGGGCGGTAATCCAGAAGCTCCTCAACACCGGCTCCCACCTCGGCCGCCGCGCCGCGGAGCACCATTT
CAAGCAATACGCCTACGGGACCCGCAACGGGATGACCATCATCGACTCCGACAAGACCCTGATCTGCCTCCGCAGCGCCG
CGAGCTTCGTCGCCAACCTCGCCAGCGCGAGGGGGAACATCTTCTTCGTCAACACGAACCCGCTCTTCGACGAGATCGTC
GAGCTCACCTCGCGCCGCATCCAGGGCGACGCGTACAACCACAACCGCTCGACGAACCTCTGGAAGATGGGAGGGTTCCT
GACGAACAGCTACAGCCCCAAGAAGTTTCGGTCCAGGCACAAGAAGCTCTGCTTCGGGCCGACGACGATGCCTGATTGCG
TTGTTGTGTTTGATGCCGAGAGGAAGAGCTCGGTGGTGTTGGAGGCGGCGAAGCTTCAGATTCCCGTGGTGGCGATCGTT
GATCCGAATGTGCCGTTGGAGTTCTTTGAGAAGATTACGTATCCTGTCCCGGCGCGTGACTCGGTGAAGTTTGTGTATTT
GTTTTGTAATGTGATCACCAAGTGCTTTGTGGCGGAGCAGATGAAGATGGGGATCAAAGATGGGGACTTGGCTGCTTGA