Details for Kale Locus Bo5g148800

Position : C5 ( 5`- 46026229 .. 46028350 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148800

Protein [Map View]
MSTQGEMEERLLRVGSDAKDRQSNSIESLYLRAKVWSEVSKMWRIALPSSLFRMTSFGSIIVAQAFIGHSSKLGLAAYAL
LQSTFIRFLYGLMGGMSSATETLCGQAYGAEQYQTMGIYLQRSWIVDIAVTTLFLPFIILAGPILRLLGQNVAITRTVDE
IYPWMIPYVYSLIFTMTMQMYLQAQMKNAIVGVLSTLSLALDILVTWWCVSFMGMGIGGALLGLNVSSWSLVLAEFVYVF
GGWCPFTWTGFSTAAFVDLVPMLKLSISSGFMICLEYWYLSILVLMAGYTEDANTAISAFSICQYIYTWELNICLGFLGA
ACVRVANELGKGDAAAVRFSIRVILTVSTIMGVIFSVLCLAFSGQISYLFTNSKEVSKAVDDLSMILAVSILLNSIQPIL
SGVAVGAGLQSIVAVVNLVSYYAIGIPLGLILTYVFHLGVKGLWSGMLAGIAIQTAILCYIIYRTDWELEVKKTSERMKA
WSLKPSREESNPIIDDERK*

DNA
ATGAGCACTCAAGGAGAAATGGAGGAGAGGCTACTACGTGTAGGATCAGATGCAAAGGATCGTCAAAGCAACAGTATAGA
GAGTCTCTATCTGAGAGCAAAGGTTTGGAGCGAAGTAAGCAAAATGTGGAGAATAGCATTACCTTCCTCTTTGTTCCGCA
TGACTTCCTTTGGTAGCATCATTGTGGCTCAAGCCTTCATCGGTCACTCCTCTAAGTTGGGTCTAGCTGCTTACGCTCTA
CTTCAAAGCACATTCATCCGCTTTCTCTACGGTTTAATGGGCGGTATGTCAAGTGCAACGGAGACTTTATGCGGGCAAGC
ATACGGTGCAGAACAGTACCAGACGATGGGGATATATCTACAACGTTCATGGATTGTTGACATAGCCGTGACCACTTTGT
TCCTACCTTTTATCATATTGGCCGGTCCTATCCTCCGTCTATTAGGACAGAATGTTGCGATCACTAGGACCGTTGATGAG
ATTTATCCTTGGATGATCCCTTATGTATACAGCTTGATCTTTACCATGACTATGCAAATGTACCTTCAAGCGCAAATGAA
GAACGCTATTGTAGGCGTGCTCTCGACCTTGTCCTTGGCTCTCGACATCCTTGTCACGTGGTGGTGTGTGAGTTTTATGG
GGATGGGGATTGGTGGTGCGCTCCTCGGGCTTAATGTGAGCTCGTGGAGTTTGGTATTAGCTGAGTTTGTGTACGTTTTT
GGTGGGTGGTGTCCGTTCACTTGGACTGGATTTAGCACTGCAGCTTTTGTTGACCTGGTTCCTATGCTCAAGCTCTCCAT
TTCTTCAGGATTCATGATCTGCTTAGAGTACTGGTACCTGAGCATCCTTGTCTTGATGGCTGGTTATACAGAAGATGCTA
ATACAGCAATATCTGCTTTCTCAATATGCCAATACATATATACATGGGAACTCAACATATGCCTTGGCTTCTTGGGTGCG
GCTTGCGTCAGAGTGGCTAACGAGTTGGGGAAAGGAGATGCAGCTGCAGTGAGATTCTCTATTAGAGTGATACTCACAGT
GTCAACAATCATGGGAGTGATATTCTCTGTTCTATGTTTAGCATTTAGCGGTCAGATATCGTATTTGTTTACTAATAGCA
AAGAGGTTTCGAAAGCAGTGGATGATCTATCGATGATCCTTGCTGTTTCAATCTTACTCAACAGCATTCAACCTATACTC
TCAGGTGTGGCAGTAGGAGCAGGGTTGCAGAGTATAGTGGCAGTTGTGAACTTAGTTTCATATTATGCAATTGGTATACC
TCTGGGTCTCATCCTTACTTATGTTTTCCATCTCGGTGTTAAGGGACTATGGTCTGGAATGTTGGCCGGTATTGCGATCC
AAACAGCGATATTGTGTTATATCATTTACAGAACTGACTGGGAGTTGGAGGTTAAAAAGACAAGCGAACGTATGAAAGCA
TGGAGCCTGAAGCCATCTCGTGAAGAGTCGAATCCTATAATAGATGATGAGAGGAAGTGA