Details for Kale Locus Bo5g148790

Position : C5 ( 5`- 46021905 .. 46023772 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148790

Protein [Map View]
MKKSVSPVSCFRLPEMVERSNTRYHRMFITRISMIFLLISILSVLSWFLILSSTNPNRVLDHISVSGPTDSPLIIIKNSE
KSPQQNDAELPNPKNSGGAKTEEVKETLQCNQKVSPPSPMPLKVYMYDMSPEFHFGLLGWKPERKGVVWPDVRVNVPHHP
GGLNLQHSVEYWLTLDLLFSELPEDSRTSRAAIRVKNYTEADVVFVPFFSSLSYNRFSKVTQKQKQSRDRELQDKLVKFV
TAQKEWKISGGKDHVIMAHHPNSMSTARHKLYPAMFVVADFGRYSPRVANVDKDIVAPYKHLVSSYANDTSGFDSRPVLL
YFQGAIYRKAGGFVRQELYYLLKEEKDVYFSFGSVQNHGISKAGVGMRSSKFCLNIAGDTPSSNRLFDAIASHCIPVIIS
DDIELPYEDVLNYNEFCIFVRASDALKKGFLLGLVRSIGREEWNKMWGRLKEVERYFDLRFPAKDDDGDHGVQMIWKAVA
RKAPLVKMKVHRFQRFTRPFLI*

DNA
ATGAAGAAGTCTGTGTCTCCAGTCTCTTGTTTTAGATTACCAGAGATGGTTGAGAGATCAAACACACGGTATCACCGAAT
GTTCATCACCAGAATATCGATGATCTTCTTGTTGATATCGATCCTCTCCGTCCTCTCTTGGTTCTTGATCCTTTCTTCCA
CAAACCCCAACCGAGTTCTTGATCACATCTCAGTCTCAGGACCTACTGATTCTCCTCTCATAATCATCAAGAACTCAGAG
AAGTCTCCCCAACAAAACGACGCCGAATTGCCAAATCCTAAAAACAGTGGAGGAGCAAAAACAGAGGAAGTCAAAGAAAC
CCTCCAATGCAACCAGAAGGTTTCTCCTCCTTCTCCAATGCCATTGAAAGTCTACATGTATGATATGAGTCCAGAGTTTC
ACTTTGGGTTATTAGGTTGGAAGCCTGAGAGAAAAGGCGTCGTTTGGCCTGACGTTAGAGTCAATGTTCCTCACCATCCT
GGTGGGCTTAACTTGCAGCACAGTGTTGAGTATTGGCTGACATTAGATCTCTTGTTCTCTGAGCTTCCAGAAGACTCTAG
AACCTCTCGTGCTGCGATACGTGTAAAGAACTATACCGAAGCTGATGTAGTCTTCGTGCCATTCTTCTCCTCATTGAGCT
ACAACAGATTCTCTAAGGTTACCCAAAAGCAGAAGCAGAGCCGAGACAGAGAACTACAGGACAAGTTGGTGAAGTTCGTG
ACGGCACAAAAGGAGTGGAAGATCTCAGGAGGGAAGGATCATGTGATAATGGCGCACCATCCTAATAGCATGTCCACGGC
GAGACATAAGCTATATCCAGCTATGTTTGTGGTCGCTGACTTCGGTAGATACTCGCCACGTGTGGCTAATGTTGATAAAG
ACATCGTAGCTCCATACAAACACCTTGTCTCATCGTACGCTAATGACACGTCAGGCTTTGATTCGCGTCCGGTCTTACTC
TACTTTCAAGGAGCCATCTACCGTAAAGCTGGTGGATTCGTGAGACAAGAGTTATATTACCTTCTGAAAGAAGAAAAAGA
CGTATACTTCTCCTTTGGAAGTGTACAAAACCACGGCATAAGCAAAGCGGGAGTAGGAATGAGATCATCTAAGTTCTGTC
TCAACATCGCTGGAGATACTCCGTCTTCTAACCGTCTCTTTGACGCCATAGCTAGTCATTGTATTCCGGTTATCATCAGC
GATGACATTGAGTTACCTTACGAGGATGTTCTCAACTACAACGAGTTCTGCATCTTTGTCCGAGCATCAGATGCTTTGAA
GAAAGGGTTTTTGTTGGGTCTTGTGAGGAGTATTGGGAGAGAAGAATGGAACAAGATGTGGGGAAGGTTGAAGGAGGTTG
AGAGGTACTTTGATTTGCGTTTTCCGGCTAAGGATGATGATGGAGATCATGGAGTTCAGATGATTTGGAAAGCTGTGGCG
AGGAAAGCTCCATTGGTGAAGATGAAGGTTCATAGGTTCCAGAGGTTTACAAGGCCTTTTTTGATTTGA