Details for Kale Locus Bo5g148770

Position : C5 ( 5`- 45998185 .. 45999976 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148770

Protein [Map View]
MPTPARNNHASSVQIQQPRTRSPLPPSPIAFKEQQGRPPPTTQQTITGKLFRNLFQGLLFSQLTLTSLLVIVLTIRGLIL
ASSHHFHPKKWYPPLLASVSASGVASLAWQCIFIYNPSRAVRATFWLSPILTCSVGILLVLIGSAVDAGVGAVFVLFAVT
QSLYGCWITPRLEYADKILSLSTAFPPPRTREVVGLSIVVSVVYSGFLVTGIGGATSTRTSLDLLFISVILIGLAWTMQV
LKNAQQVAVSRARYVNFAHGEDMDAWSALHVTVKHLIGSICIGSTLVPIIVLIRGSIRSVNLMSGSSDEVMYSGADCFST
LANKVVTCGNRWGFVHVGTYDKGFVEASSDTWKKFRSINGLEEVIDSDLTSSLCFLGAVSVGAVSSLTAGIWMLLIHKNY
ALEVTLYAYIIGYFVGRVALAWLQACVSAYYVAYSEDPHSMRFDGTIPQRIQRLQMLRAHRDNRERERQESDESP*

DNA
ATGCCAACACCAGCAAGGAACAACCATGCCTCTAGCGTGCAGATTCAACAACCAAGAACAAGATCTCCTCTTCCTCCTTC
TCCAATCGCCTTCAAGGAACAACAAGGTAGACCACCTCCCACCACACAACAAACAATAACCGGAAAACTCTTTAGAAACC
TCTTCCAGGGTCTTCTCTTCTCACAACTGACCTTAACCTCACTCTTAGTAATTGTCCTCACCATTCGCGGTCTCATCTTA
GCAAGCTCACACCACTTCCACCCCAAGAAATGGTATCCTCCTTTGCTAGCGTCCGTATCCGCCTCAGGAGTTGCATCTTT
AGCCTGGCAATGCATCTTTATCTACAATCCATCGAGAGCAGTCAGAGCAACGTTCTGGCTTAGCCCTATACTCACCTGCT
CGGTGGGTATCTTGCTTGTTCTGATTGGCTCAGCTGTAGATGCAGGGGTTGGTGCTGTCTTTGTGCTTTTCGCCGTCACT
CAGTCTTTATACGGTTGCTGGATTACTCCAAGGCTTGAATATGCGGACAAGATACTATCACTCTCCACAGCTTTTCCACC
TCCAAGAACCAGAGAAGTAGTCGGTTTATCGATCGTGGTAAGTGTGGTTTACTCTGGCTTCTTGGTGACTGGCATAGGAG
GTGCAACTTCCACTAGAACAAGTCTAGATCTCTTGTTCATATCTGTAATCTTGATAGGGTTAGCATGGACCATGCAAGTT
CTCAAGAACGCACAACAAGTTGCTGTTTCGCGTGCGAGATACGTAAACTTTGCACACGGAGAAGATATGGACGCTTGGAG
TGCGTTACACGTCACTGTGAAGCACTTGATTGGGAGCATCTGCATTGGCTCGACGCTTGTTCCTATCATAGTACTCATCA
GAGGATCGATCAGAAGCGTTAATCTAATGTCAGGGAGCAGCGACGAGGTTATGTACTCAGGTGCTGACTGCTTCTCCACC
CTCGCCAACAAGGTGGTTACGTGTGGAAACAGATGGGGCTTTGTGCATGTGGGAACGTATGACAAAGGCTTCGTGGAGGC
TTCGAGTGATACGTGGAAGAAGTTCAGAAGTATAAACGGGTTAGAGGAAGTGATTGATTCGGATCTCACTAGCTCCTTGT
GCTTCCTCGGTGCGGTTTCTGTTGGAGCAGTGTCTTCGTTGACCGCAGGAATATGGATGTTGTTGATCCACAAGAACTAT
GCTCTTGAAGTGACACTCTATGCTTACATTATTGGATATTTCGTGGGGAGGGTAGCTTTGGCGTGGCTACAAGCGTGTGT
CTCGGCGTACTATGTAGCTTACTCCGAAGATCCTCATAGCATGCGGTTTGATGGTACGATTCCACAGCGTATTCAGCGTC
TTCAGATGTTAAGGGCTCACCGAGATAACAGGGAGAGGGAGAGACAAGAGAGTGATGAGTCTCCATGA