Details for Kale Locus Bo5g148760

Position : C5 ( 5`- 45992352 .. 45997179 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148760

Protein [Map View]
MLTSPSNALHSTPPFFPIRRSKPCRSRNFHSGGGKLCSLSLLSASRFSVRALVRPDVVSEDGGGPSGALSFPNYISVKIP
FGNREILVETGLMGRQASSSVTVTDGETIVCTPVCVADVPSEPSDFLPLYVHYQERFSAVGRTSGGFFKREGKTKDHEVL
ICRLIDRPLRPTMPKGFYNETQILSWVLSYDGLHAPDALAVTSAGIAVALSEVPNAKAIAGVRVGLIGGEFIVNPTVKEM
EESQLDLFLAGTDTAILTIEGYSNFLPEEMLLQAVKVGQDAVQATCTAIEALAKKHGKAKMVDAIRLPPPDLYKHVKELA
GEELSKALQIKGKIARRKAISSLEEKVLTVMTEKGYVVDEVAFGTTEAQPELLEDEDEDEEVVPEGEVDQGDVHIRPIPR
KPIPLLFSEVDVKLVFKEVSSKLLRRRIVEGGKRSDGRTPDGIRPIDSRCGLLPRAHGSSLFTRGETQALAVVTLGDKQM
AQRIDNLEGSDEYKRFYLQYTFPPSSVGEVGRIGAPSRREIGHGTLAERALETILPSDDDFPYTIRVESTILESNGSSSM
ASVCGGCLALQDAGVPVKCSVAGIAMGMVWDTEEFGGDGSPLILSDITGAEDASGDMDFKVAGNEDGVTAFQMDIKVGGI
TLQIMEKALIQAKAGRRHILAEMAKCSPPPTLSLSKYAPLIHIMKVHPSKVYSLIGSGGKKVKSIIEESGVEAIDMQDDG
IVKIMANNVASLERAKAIISGLTMVPVLGDIYRNCEIKSMAPYGAFVEIAPGREGLCHVSELSAEWLAKPEDAYKIGDRI
DVKLIEVNEKGQLRLSVRALLPESETGKDSQKPPPTGDSNKDKGSPRKYVNTSSKDRAASKVASGDELVLKKKDVRRSAA
GDMPMKSNSSSNEEDRGGLVNGEATIS*

DNA
ATGCTGACGAGTCCAAGCAACGCGCTTCACAGTACTCCACCCTTCTTCCCTATTCGCCGGAGCAAGCCTTGCCGTTCCCG
GAATTTCCACTCCGGCGGAGGAAAACTCTGCTCGCTCTCTCTCCTCTCCGCGAGTAGATTCAGCGTGAGAGCTCTAGTTA
GACCAGATGTTGTCTCCGAGGACGGCGGTGGGCCCTCTGGAGCTCTGTCGTTTCCTAACTACATTTCTGTCAAAATCCCT
TTCGGAAACAGAGAGATTTTAGTTGAGACTGGTCTGATGGGGAGACAAGCAAGCTCTTCAGTTACTGTGACAGATGGAGA
AACTATTGTCTGCACACCAGTTTGTGTAGCTGATGTCCCTAGTGAGCCATCAGATTTTCTTCCCCTTTATGTTCACTATC
AGGAGCGCTTCTCAGCTGTTGGTCGAACTAGTGGTGGATTTTTTAAGAGAGAAGGGAAAACCAAAGATCATGAGGTTCTG
ATTTGTAGGTTGATCGATAGACCTCTACGCCCCACTATGCCCAAAGGTTTCTACAACGAAACTCAGATACTATCCTGGGT
TTTGAGCTACGATGGGTTACACGCACCTGATGCTTTGGCTGTTACATCTGCTGGAATAGCTGTAGCTCTTTCAGAAGTAC
CGAACGCAAAGGCAATTGCAGGAGTTAGAGTTGGTCTTATTGGGGGCGAGTTTATCGTCAATCCAACCGTGAAGGAGATG
GAAGAATCACAGCTAGATTTGTTTCTAGCTGGAACAGATACTGCAATTTTAACCATAGAGGGATATAGTAATTTTCTTCC
TGAGGAAATGCTGCTCCAAGCTGTTAAAGTTGGACAGGATGCTGTACAAGCTACATGCACTGCTATTGAAGCTTTGGCAA
AGAAACATGGAAAGGCCAAAATGGTTGACGCTATTAGATTACCACCTCCTGATCTATACAAGCATGTCAAAGAACTTGCT
GGTGAGGAACTGAGCAAAGCGCTACAGATTAAGGGCAAAATAGCGAGAAGGAAAGCAATATCATCCCTGGAAGAAAAGGT
CTTGACAGTAATGACTGAGAAGGGATATGTCGTTGATGAGGTAGCGTTTGGAACCACAGAAGCACAGCCGGAGTTATTGG
AGGATGAAGATGAGGATGAGGAAGTTGTTCCTGAAGGTGAGGTGGACCAAGGTGATGTTCACATAAGGCCTATCCCTCGG
AAACCTATTCCTTTGCTATTTTCGGAAGTAGATGTGAAGCTGGTCTTTAAAGAAGTATCGTCAAAGCTCCTGCGCAGGCG
AATTGTTGAGGGAGGTAAAAGAAGTGATGGTCGAACTCCGGATGGGATCAGGCCAATTGACTCTAGATGTGGCCTGCTTC
CAAGGGCACATGGCAGCTCTCTTTTCACACGTGGTGAAACACAGGCACTGGCAGTTGTTACTCTTGGTGATAAACAAATG
GCGCAAAGAATTGACAACCTTGAGGGTTCTGATGAATACAAGAGGTTTTATCTTCAGTACACTTTTCCTCCATCGTCTGT
TGGTGAAGTTGGAAGAATTGGAGCACCCAGTAGAAGAGAAATAGGTCATGGGACACTAGCAGAGCGAGCATTGGAGACTA
TATTACCAAGTGATGATGACTTTCCTTACACAATACGTGTTGAGAGTACAATACTTGAAAGCAATGGTTCTTCAAGCATG
GCATCTGTTTGTGGCGGCTGCTTGGCTTTGCAAGATGCTGGAGTTCCAGTCAAATGCTCTGTTGCTGGCATAGCAATGGG
AATGGTTTGGGATACAGAAGAATTTGGCGGTGATGGATCTCCTCTTATCCTTTCTGACATCACTGGAGCTGAAGATGCAT
CCGGTGATATGGACTTTAAGGTTGCTGGGAACGAAGATGGTGTTACTGCGTTTCAAATGGACATAAAGGTAGGAGGAATC
ACGTTACAGATAATGGAAAAGGCTTTGATACAGGCAAAAGCTGGGCGTCGCCATATTCTTGCTGAAATGGCAAAGTGCTC
ACCGCCTCCTACGTTGAGTCTCTCAAAATACGCTCCGTTGATACATATTATGAAGGTACATCCAAGCAAAGTGTACTCCC
TCATTGGTTCCGGTGGGAAGAAAGTAAAGAGTATCATTGAAGAATCCGGAGTTGAAGCCATTGATATGCAAGATGATGGA
ATTGTGAAAATTATGGCAAACAATGTGGCGAGTCTGGAGAGGGCCAAAGCCATTATCAGTGGATTGACAATGGTTCCAGT
TCTTGGCGATATCTACAGGAACTGTGAAATCAAATCAATGGCTCCCTATGGTGCCTTTGTAGAGATTGCGCCTGGGAGAG
AAGGACTTTGCCATGTCAGTGAGCTGAGTGCTGAATGGCTTGCTAAACCTGAGGATGCCTATAAAATAGGAGACCGCATT
GATGTCAAACTAATAGAGGTGAACGAAAAAGGTCAGCTTCGGCTTAGTGTAAGAGCTTTACTTCCGGAATCTGAGACGGG
CAAAGACAGTCAGAAACCACCTCCGACGGGTGATTCTAACAAGGACAAGGGTTCACCAAGGAAATATGTAAATACTTCAT
CCAAGGACCGTGCAGCATCAAAAGTTGCATCTGGGGATGAACTAGTCTTGAAGAAGAAAGATGTCAGGAGATCAGCCGCT
GGTGACATGCCAATGAAAAGCAATAGCAGTAGCAACGAAGAAGATAGAGGCGGCTTAGTCAATGGTGAAGCTACAATCAG
CTAG