Details for Kale Locus Bo5g148750

Position : C5 ( 5`- 45988352 .. 45991712 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148750

Protein [Map View]
NIFGLNHLKNHKLLSDILQESLFSTFSQKVRIVHASQSISYTSSGLRHLSRFVGKTNSSWSLFFLADMNENGGSSKKCSW
GFNSLVRRKQVDSVHLKNDHGHHHHQLAKKLTAFDLVAIGVGTTIGAGVYILVGTVAREHTGPALAVSFFIAGVAAALSA
CCYAELASRCPSAGSAYHYAYICLGEGIAWLVGWALVLDYTIGGSAIARGISPNLASFFGGLDKLPVFLARQTIPGLGIV
VDPCAALLIMIVTILLCFGIKESSLVQAIVTSVNVCTLVFIIVVGGYTAFKTGWVGYDLSTGFFPFGLNGILAGAAVVFF
SYIGFDTVTSTAEEVKNPQRDLPLGIGIALLICCVLYMLLSVVIVGLVPYYTLDPDTPISSAFGDSGMQWAAYILTTGAI
TALCASLLGSLLAQPRIFMAMARDGLLPAFFAEIDPRTQVPVKNTIVIGVLAASLAFFMDVSQLSEMVSVGTLVAFTAVA
VCVLVLRYVPPYGVPLPSSSQTWTDKNESRLQTERFLVNDAIESSDSPLLGARDEKYFGKRRKIAAWSIVLVCIGVLGLS
SAASAERLPSLPRFTMCGVSAAILLGSLITLGCIDEDDERHNFGHQGGFLCPFVPYLPVLCILINTYLIINIGVGTWIRV
LIWLLVGSMIYLFYGRSHSLLNNAGYVPTTCTGKTTDHHP*

DNA
AATATCTTTGGATTAAATCATTTAAAAAATCACAAACTTTTATCTGACATTCTTCAGGAATCTTTGTTTTCTACCTTTTC
TCAAAAAGTTAGAATCGTGCACGCCTCTCAAAGTATCTCATATACCTCATCTGGATTGAGACATCTTTCAAGGTTTGTTG
GAAAAACCAATTCCTCGTGGAGTCTTTTTTTTTTGGCTGACATGAACGAGAACGGTGGTTCAAGCAAAAAGTGTTCATGG
GGTTTCAATAGTCTTGTAAGAAGGAAACAAGTTGATTCTGTTCATCTCAAAAACGACCATGGACATCATCATCATCAGCT
TGCCAAGAAACTAACAGCCTTTGATCTTGTCGCTATTGGAGTTGGAACAACAATAGGAGCAGGAGTGTACATTCTCGTGG
GAACAGTAGCTAGAGAACACACAGGACCTGCTCTTGCTGTATCATTCTTCATCGCTGGAGTAGCAGCTGCTCTCTCCGCT
TGTTGCTACGCTGAGCTTGCTTCTCGTTGTCCATCTGCTGGCAGTGCTTATCATTATGCATACATATGCCTTGGAGAAGG
GATTGCTTGGTTGGTTGGTTGGGCACTGGTGTTGGATTATACTATTGGTGGATCAGCCATTGCACGTGGCATATCTCCAA
ATCTGGCATCCTTTTTTGGAGGGTTAGACAAACTTCCTGTGTTCTTAGCTCGACAAACCATACCCGGACTTGGTATTGTG
GTTGATCCATGTGCAGCATTGTTGATTATGATTGTTACAATACTACTATGCTTTGGGATAAAGGAGAGCTCATTAGTACA
AGCAATTGTAACATCAGTGAATGTTTGCACGTTGGTTTTCATAATAGTAGTTGGTGGATATACAGCTTTCAAGACCGGTT
GGGTTGGATATGATCTTTCCACTGGGTTTTTTCCTTTTGGATTAAATGGGATACTCGCCGGAGCTGCGGTAGTATTCTTC
TCATACATTGGATTTGATACAGTGACTAGCACAGCTGAAGAGGTTAAAAATCCTCAAAGGGATCTTCCATTGGGCATTGG
GATTGCATTACTGATATGCTGCGTTTTATATATGCTTTTATCAGTAGTTATCGTTGGGTTGGTCCCTTACTATACTTTGG
ATCCTGATACTCCTATCTCCTCTGCATTTGGAGACAGTGGGATGCAATGGGCAGCGTACATCTTAACTACTGGAGCAATA
ACTGCTCTATGCGCTAGTTTGTTGGGTTCACTTTTGGCTCAGCCACGGATCTTCATGGCAATGGCTAGGGACGGATTGTT
GCCAGCTTTCTTTGCAGAAATTGACCCACGAACTCAAGTACCGGTGAAAAACACAATAGTAATTGGTGTGCTGGCCGCTT
CACTGGCATTTTTCATGGATGTTTCACAGTTATCCGAGATGGTTAGTGTAGGCACGCTGGTGGCTTTCACTGCTGTAGCA
GTATGTGTGCTAGTTCTCAGATATGTACCACCATATGGTGTTCCCCTACCATCCTCCTCTCAAACATGGACTGATAAAAA
TGAAAGTAGGCTGCAAACTGAACGTTTTCTTGTGAATGATGCTATAGAATCATCTGATTCTCCTCTACTTGGCGCTCGAG
ATGAAAAGTACTTTGGAAAGAGAAGAAAAATTGCTGCCTGGAGTATAGTTCTTGTGTGCATAGGTGTCTTAGGCCTTTCT
TCAGCAGCTTCTGCTGAGCGTCTTCCAAGTTTACCTCGGTTCACTATGTGTGGTGTCAGTGCAGCCATCTTACTTGGCAG
TTTGATTACTCTTGGTTGCATCGATGAGGATGATGAAAGGCACAACTTTGGACACCAAGGAGGGTTTCTCTGCCCATTTG
TCCCATACCTTCCTGTTCTCTGCATTTTGATCAACACCTACTTGATCATCAACATTGGAGTTGGGACATGGATCAGGGTC
TTGATATGGCTGCTTGTTGGAAGCATGATCTATCTCTTCTATGGCCGGTCTCACAGCTTACTGAACAATGCAGGCTATGT
TCCAACGACTTGTACAGGGAAAACAACAGATCATCATCCTTGA