Details for Kale Locus Bo5g148740

Position : C5 ( 5`- 45985701 .. 45987322 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148740

Protein [Map View]
MEKQSLPKKPRPLGESQFLRCAELILPWLNAPELAAVSLTSKALTFVSRSITLRRSLDAARSLESLPVPFLNAVDSKRYA
DFAYTPFQIPATSPPMRQRWGGGASDAPVSQFEMNVVGESMYGCECERCEEGYCQCLSLAAGAEIANECGSGCGCGSDCP
NRVTQKGVLVRLKIVRDEKKGWCLCSDQLIKKGQFICEYAGELLTTAEARRRQTVYDKLRSTQQSFSSALLVIREHLPSG
QACLRINIDATSIGNVARFINHSCDGGNLSTVLLRSSGALLPRLCFFAARDIVAGEELCFSYGDVRLTPGKSAENKLNCS
CGSSCCFGTLPCENT*

DNA
ATGGAGAAACAGTCACTACCGAAGAAGCCTCGTCCTCTCGGAGAATCTCAGTTTCTCCGATGCGCCGAGTTGATTCTCCC
GTGGCTAAACGCCCCAGAGCTCGCCGCTGTCTCTCTAACCTCTAAAGCCTTAACCTTTGTCTCCAGATCCATCACTCTCC
GTCGATCCCTCGACGCCGCACGCTCCCTCGAGAGCCTCCCCGTCCCGTTCCTCAACGCCGTCGATTCCAAACGCTACGCT
GACTTCGCCTACACGCCTTTCCAGATCCCCGCCACCTCTCCTCCGATGCGGCAGCGGTGGGGAGGAGGAGCTAGCGATGC
TCCGGTGAGTCAGTTTGAGATGAATGTGGTTGGAGAGAGTATGTATGGATGCGAGTGCGAGAGGTGTGAGGAAGGATACT
GCCAGTGCTTATCACTCGCGGCAGGCGCGGAGATAGCTAATGAGTGTGGGTCGGGTTGTGGATGCGGGTCGGATTGTCCG
AACCGGGTGACTCAAAAGGGGGTTTTGGTTAGGTTGAAGATTGTTAGAGATGAGAAGAAAGGTTGGTGCTTGTGCTCTGA
TCAGCTAATCAAGAAAGGCCAATTCATCTGTGAATATGCAGGTGAGCTGTTGACAACAGCTGAAGCACGTAGACGTCAAA
CTGTCTACGACAAACTCAGGTCAACGCAACAATCCTTCTCCTCAGCTCTCCTAGTCATACGCGAGCACCTTCCTTCAGGA
CAAGCTTGCTTGAGAATAAACATCGACGCCACAAGCATCGGTAACGTTGCTAGATTCATTAACCATTCTTGCGACGGCGG
GAATCTATCCACCGTCCTACTGAGAAGCTCGGGGGCTTTGCTTCCTCGCCTATGTTTCTTTGCAGCGAGGGACATTGTTG
CAGGGGAGGAGTTATGTTTCAGTTATGGAGATGTACGTCTCACTCCAGGGAAGAGCGCAGAGAACAAGTTGAATTGCTCT
TGTGGTAGTTCCTGCTGTTTTGGAACATTGCCTTGCGAGAACACCTGA