Details for Kale Locus Bo5g148730

Position : C5 ( 5`- 45982553 .. 45985488 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148730

Protein [Map View]
MGKQLCGLPLLLLVLLLSSIDGTTQLQSSQSQTLLRLQQLLYYPKVLTSWNNFTDFCNSEPNSSLTVVCYEDSITQLHIT
GDRRGHMLPKSFSIDSFVTTLAKLPDVKVLTLVSLGLWGRLPDKINRLSSLEILNVSSNFLFGPVPHELSSLASLQTLIL
DENMFSGLVPDWIGSLPSLAVLSLRKNAFNGSLPSSLSTLSGLRVLSLANNRFSGALPDLSRLTNLQVLDLESNSFGPMF
PRLSHKLVTLILSKNMFRSAVSSQEVTSFYQLQHFDLSFNTFVGPFPTSLMSLPAITYLNISHNKLTGRLSTNLSCNSQL
MSVDLSSNLLTGSLPDCLKPSSGVSRDVVYGGNCLANANEDQRPVSFCSNEALAVGIIPQRRNRVKSKLGVALGVTGGVL
GLILLAGAVFVVLRRVSAKRKATEASPRFIKENVSMGYTSKLLSDARYISQTMKLGALGLPSYRTFSLEELEYATNNFES
SAFMGEGSQGQIYRGRLKDGSFVAIRCLKMKKSCSTQNLMHHIELIAKLRHRHLVSVLGHCFECYLDDSTVSRMFFVFEY
VPNGELRSWISDGHVGRLLTWEQRISVAIGVAKGIQFLHTGIVPGVYDNNLRITDVLLDSNLAAKISSYNLPLLVEGLGK
VSDVKSLNLVSFLNLLAECVLLFFLRWDKLYQEKELQGVIKDEDKVDIYDFGVILLELIVGRPLKAKGQVDVLKEQLQAS
ISADDGARRSMVDPAVHRTCSDQSLKTMMEICVRCLLKDPLERPSIEDVLWNLQFASQVQEGWLHNSNPPSIRGSPSPAA
SSRLHVTTLELPRDSGYEEHER*

DNA
ATGGGGAAACAATTGTGTGGCTTGCCTTTACTGCTTCTGGTTCTGCTTTTATCCTCTATTGATGGAACAACACAGCTTCA
ATCATCTCAATCTCAAACCCTTTTGAGGCTTCAACAGCTTCTCTACTACCCCAAAGTCTTAACCAGCTGGAACAACTTCA
CAGACTTCTGCAACTCCGAACCAAACTCCTCCCTAACCGTTGTATGCTACGAAGATAGTATAACGCAGCTTCACATCACA
GGAGACAGAAGAGGCCACATGTTACCAAAGAGTTTCTCAATAGACTCGTTTGTCACTACTCTTGCTAAGCTCCCTGATGT
CAAAGTCCTCACCCTTGTCTCCCTCGGTTTATGGGGTCGGTTGCCTGATAAAATAAACCGTTTGTCCTCATTAGAGATTC
TCAATGTGAGTTCTAACTTCCTCTTTGGACCTGTACCACATGAACTGTCCTCGCTTGCTAGCCTTCAGACCCTTATACTC
GATGAGAATATGTTCTCTGGTCTTGTACCGGATTGGATTGGTTCTTTACCGAGTTTAGCTGTGCTGAGTCTAAGAAAAAA
TGCATTCAACGGATCTTTACCTTCTTCGCTGAGTACCTTGTCAGGTCTTAGAGTTCTTTCTCTAGCTAATAACCGGTTTA
GTGGAGCTTTACCTGATCTAAGCCGTTTGACAAACCTTCAAGTGCTTGATCTTGAATCAAACTCATTCGGACCGATGTTT
CCTAGGTTAAGTCACAAGTTGGTGACTCTTATACTCAGCAAGAACATGTTTAGATCCGCAGTATCATCTCAAGAAGTGAC
TTCTTTCTATCAGCTTCAACATTTTGATCTTTCATTCAACACATTCGTTGGTCCTTTTCCTACTTCCTTGATGTCTCTCC
CAGCAATAACTTACTTGAACATTTCACACAACAAACTCACCGGGCGGCTTTCGACAAATCTCTCTTGCAACTCACAGCTG
ATGTCTGTTGATCTATCATCTAATCTTCTTACCGGAAGCTTGCCTGATTGTCTTAAACCTAGCTCAGGAGTTAGCAGAGA
TGTTGTCTATGGAGGTAACTGTCTGGCTAATGCAAATGAAGACCAGCGTCCAGTTTCATTTTGTAGCAATGAAGCTCTCG
CTGTTGGGATCATACCACAGAGGAGGAACAGAGTTAAATCCAAGTTGGGTGTTGCCTTAGGTGTAACAGGAGGCGTCCTA
GGGTTGATTCTCCTCGCTGGTGCAGTGTTTGTAGTTCTTAGGAGAGTTAGTGCTAAGAGGAAAGCAACAGAAGCTTCTCC
AAGATTTATCAAAGAGAATGTTTCAATGGGATACACATCAAAGCTACTCTCAGATGCAAGGTATATATCTCAAACAATGA
AGCTAGGAGCGCTTGGTCTTCCTTCTTACAGGACATTCTCACTGGAAGAGCTTGAGTATGCTACAAACAACTTTGAATCA
TCTGCTTTCATGGGTGAAGGTTCTCAAGGACAGATTTATAGAGGGAGGTTGAAGGATGGATCATTTGTGGCGATTAGATG
TTTAAAAATGAAGAAAAGTTGCAGCACTCAGAACCTGATGCACCACATTGAGCTCATTGCTAAACTGAGGCACCGTCACT
TGGTTAGTGTGCTGGGGCATTGTTTTGAGTGCTACTTAGATGATTCAACAGTCAGCAGAATGTTCTTCGTCTTTGAGTAT
GTGCCAAATGGTGAACTCAGGAGCTGGATCTCTGATGGGCATGTGGGAAGATTGCTTACTTGGGAGCAACGCATAAGTGT
AGCGATTGGTGTAGCAAAAGGGATCCAGTTCTTGCATACTGGTATCGTCCCTGGTGTTTATGATAACAACTTGAGGATAA
CAGACGTTTTGCTTGACAGTAACCTCGCTGCAAAAATCAGTAGCTATAACCTTCCATTGCTTGTGGAAGGTCTTGGAAAG
GTAAGTGATGTTAAAAGTCTAAATCTTGTTAGCTTCTTGAATCTGTTAGCTGAATGTGTTTTGCTTTTCTTTTTAAGGTG
GGACAAGTTGTATCAAGAAAAGGAACTCCAAGGTGTCATCAAAGATGAAGATAAAGTAGATATCTATGACTTTGGAGTGA
TCTTGCTTGAACTTATAGTGGGAAGACCATTGAAAGCAAAGGGTCAAGTCGATGTTCTAAAAGAGCAGTTACAAGCGAGC
ATCTCAGCGGATGATGGAGCGCGTAGGAGCATGGTGGATCCAGCGGTCCACAGAACTTGTTCAGACCAATCACTCAAGAC
AATGATGGAGATATGTGTAAGGTGTCTCCTCAAAGACCCTCTAGAACGGCCTTCCATTGAAGATGTTCTTTGGAATCTTC
AGTTTGCTTCTCAAGTCCAAGAAGGTTGGCTACATAACAGCAATCCTCCTAGCATTCGCGGCTCGCCTTCTCCTGCAGCT
TCCTCTCGTTTGCACGTAACAACACTCGAATTACCACGAGACTCAGGATATGAAGAGCATGAGAGGTAG