Details for Kale Locus Bo5g148720

Position : C5 ( 5`- 45973047 .. 45976397 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148720

Protein [Map View]
MAINKLGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSLLPKVIPIYNAAYAGLESTLSGLNVLVETYFADVPAEAYKTL
TSLKGVTAFGFDLIRGTKTIDLIKSSFPKGKYLFAGVVDGRNIWANDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAV
DLVNETKLDAEIKSWLAFAAQKVVEVDALAKALAGQKNESFFSANAAALSSRRSSPRVTNESVQKAAAALKGSDHRRATE
VSTRLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEDLDIDVLVHGEPERND
MVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSTAQSMTKRPMKGMLTGPVTILNWFFVRNDQP
RHETCYQIALAIKDEVEDLEKGGIGVIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFND
NIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPRVYDIHSPRIASTDEIADRINKMLAVLEQNILWVNPDCGL
KTRKYTEVKPALKNMVHAAKLIRSQLASAK*

DNA
ATGGCTATAAATAAGCTTGGTGTGGAGACAGTCCCTGTACTTGTTGGTCCTGTCTCTTACTTGCTTCTTTCCAAGCTTGC
AAAGGGTGTTGACAAATCATTTGATCTTCTCTCCCTTCTCCCGAAAGTCATCCCAATCTACAACGCTGCCTATGCTGGTC
TTGAATCAACTCTCTCTGGTCTGAATGTTCTTGTGGAGACTTACTTCGCTGATGTCCCTGCTGAAGCATACAAGACCCTT
ACTTCCTTGAAGGGTGTGACTGCCTTTGGTTTTGATTTGATCCGTGGAACCAAGACCATTGACTTGATCAAGTCTAGTTT
CCCTAAGGGCAAGTACCTCTTTGCTGGTGTTGTTGATGGAAGGAACATCTGGGCCAATGACCTCGCTGCCTCTCTCATTA
CCTTGCAGTCACTTGAGGGTGTTGTTGGTAAAGACAAGCTTGTGGTCTCAACCTCTTGCTCTCTTCTCCACACGGCTGTT
GACCTTGTTAACGAGACTAAGCTGGATGCTGAAATCAAGTCGTGGTTAGCTTTTGCCGCGCAGAAGGTTGTTGAAGTTGA
TGCTCTAGCCAAGGCTTTGGCTGGTCAGAAGAATGAGAGTTTCTTCTCTGCCAACGCTGCTGCTTTGTCTTCAAGGAGGT
CTTCTCCAAGAGTCACCAACGAGTCTGTCCAGAAGGCTGCTGCTGCTTTGAAGGGATCAGACCACCGGCGTGCAACTGAA
GTAAGCACAAGACTAGATGCTCAACAGAAGAAGCTGAACCTCCCCATCCTCCCAACCACAACCATTGGATCCTTCCCACA
GACCGTTGAACTCAGGAGAGTTCGCCGTGAATACAAGGCCAAGAAAATCTCTGAAGAGGATTACGTCAAGGCCATCAAGG
AAGAGATCAAGAAGGTTGTTGACATCCAAGAAGATCTTGACATCGATGTACTCGTCCACGGAGAGCCTGAGAGAAACGAC
ATGGTTGAGTACTTTGGAGAGCAATTATCAGGTTTCGCATTCACAGCAAACGGGTGGGTACAATCCTATGGATCACGTTG
CGTGAAGCCACCGATCATCTACGGTGACGTGAGCCGTCCCAAGCCAATGACAGTCTTCTGGTCTTCAACAGCTCAGAGCA
TGACTAAACGTCCCATGAAGGGTATGCTCACAGGACCAGTCACGATTCTTAACTGGTTTTTTGTCAGAAACGACCAGCCT
AGGCACGAGACTTGTTACCAGATTGCTTTGGCTATCAAAGACGAAGTGGAAGATCTTGAGAAAGGTGGTATTGGAGTCAT
TCAGATTGATGAAGCTGCTCTTAGAGAAGGGTTGCCTCTTAGAAAAGCAGAACACTCTTTCTACTTGGATTGGGCTGTTC
ACTCTTTCAGAATCACTAACTGTGGCGTCCAAGACAGCACTCAGATCCACACTCACATGTGCTACTCAAACTTCAACGAC
AATATCCACTCCATCATCGACATGGATGCTGATGTAATCACCATTGAGAACTCACGTTCAGACGAGAAGCTTCTCTCGGT
GTTCCGTGAAGGAGTGAAGTACGGTGCAGGTATCGGTCCTCGTGTTTACGACATACACTCACCGAGAATAGCATCAACAG
ATGAAATAGCAGACAGGATCAACAAGATGCTTGCGGTTCTTGAGCAGAACATCTTGTGGGTTAACCCTGACTGTGGTCTG
AAGACGAGGAAGTACACTGAGGTCAAGCCAGCACTTAAGAACATGGTTCATGCGGCTAAGCTTATCCGCTCCCAGCTCGC
CAGTGCCAAGTGA