Details for Kale Locus Bo5g148700

Position : C5 ( 5`- 45963693 .. 45964453 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148700

Protein [Map View]
MVVTGQQADEEMVDRLLETGYSEQIFQKAIMEQGRGQIMDTLAEIQERHDAVRGLEKKLLDLQQVFLDMAVLVDAQGEML
DNIENMVSSAVDHVQSGNNQLTKALKKQKSSRKWMCISILILLIIVIITVVSVLKPWTQKHGA*

DNA
ATGGTAGTGACTGGCCAACAAGCTGATGAAGAGATGGTTGATCGATTGCTTGAAACCGGATACAGTGAGCAGATTTTCCA
GAAAGCAATCATGGAGCAGGGACGAGGTCAGATAATGGATACACTGGCTGAGATTCAGGAACGCCATGATGCTGTCAGAG
GATTAGAGAAGAAACTCCTTGACCTACAACAGGTGTTTCTTGATATGGCCGTGCTGGTGGATGCACAGGGAGAGATGCTA
GACAACATAGAGAACATGGTCTCCAGCGCTGTGGACCATGTTCAATCCGGGAACAACCAGCTAACAAAGGCACTAAAGAA
ACAGAAAAGTTCGAGGAAATGGATGTGCATTTCCATCCTCATCCTTCTTATCATCGTCATCATTACCGTTGTCTCTGTTC
TCAAACCATGGACACAGAAACATGGTGCCTAA