Details for Kale Locus Bo5g148640

Position : C5 ( 5`- 45947206 .. 45947535 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148640

Protein [Map View]
MEKISMKFALVIFLVVASVMSIEATRLLTEEALETVLHGESLPHGEEKFHFGVHCEKGCHEECYPDQFITRCFCVCP*

DNA
ATGGAAAAGATATCAATGAAGTTTGCTCTTGTTATTTTCTTAGTTGTTGCATCCGTGATGAGTATTGAGGCAACACGGTT
ATTAACCGAAGAAGCTCTTGAAACGGTTCTGCATGGTGAATCTTTGCCGCATGGCGAGGAAAAATTCCATTTTGGTGTTC
ACTGCGAGAAAGGGTGTCATGAGGAATGTTATCCCGATCAATTTATTACAAGATGTTTTTGTGTGTGCCCATAA