Details for Kale Locus Bo5g148620

Position : C5 ( 5`- 45880113 .. 45881444 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148620

Protein [Map View]
MTSSQGDMDLEEWELLPKSYFKDLDLDHDEDHQEAMILDCFLSPSTQDPLHKIESPPRSIVVLTKPLQVPMAWEPVLDHE
NKNIPDLDPDPTQTLLMESVPSPSVSFKKSKETEFADMKIDPPAWITSPVPSIDAASCEGSVDLRVKKENDDVTSGHGGE
KLNLWKIGLNGIGAVCSFGVAAAAATVCVLFLGHNNIKVCKNKNHKLRFQIYSDDHKRMNEAVNHATKVNEAIFAMKGVP
VVRAQISFGGHYDGL*

DNA
ATGACATCATCTCAAGGAGACATGGATCTTGAGGAGTGGGAGTTACTCCCCAAAAGCTATTTCAAGGATCTTGATCTTGA
TCATGACGAGGATCATCAAGAAGCCATGATACTGGATTGCTTCCTCTCCCCATCTACTCAAGATCCTCTCCACAAGATAG
AGTCTCCTCCAAGATCCATAGTTGTCCTCACAAAGCCCCTCCAAGTCCCCATGGCTTGGGAACCAGTGTTGGATCACGAG
AACAAGAATATCCCCGATCTTGACCCGGATCCAACACAGACCCTTTTGATGGAGTCTGTTCCGTCACCAAGCGTATCCTT
CAAGAAATCGAAGGAAACTGAATTTGCCGACATGAAAATTGACCCACCAGCGTGGATCACGAGTCCTGTGCCTTCGATAG
ATGCTGCGAGTTGCGAAGGAAGCGTTGACTTGCGAGTGAAGAAAGAGAATGATGATGTGACGAGTGGACATGGTGGTGAG
AAACTGAACTTATGGAAGATTGGTCTTAATGGGATCGGAGCTGTTTGCTCTTTTGGCGTTGCAGCAGCAGCTGCTACAGT
ATGTGTCTTGTTCCTCGGACACAACAACATCAAAGTTTGTAAGAACAAGAACCATAAGCTTAGGTTCCAGATTTACTCCG
ATGATCATAAGAGGATGAATGAAGCTGTGAATCATGCAACAAAGGTTAATGAAGCAATCTTTGCAATGAAAGGTGTTCCT
GTCGTAAGAGCTCAAATATCTTTTGGAGGTCACTACGATGGACTTTGA