Details for Kale Locus Bo5g148610

Position : C5 ( 5`- 45877793 .. 45878581 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148610

Protein [Map View]
MSSLEQEMFLQWGNKKRMRRLRASANKDTKHISQRQSNSSSHETFLFHSSRFSRGSEGAILRSGPPPEKEKEERYYTTRG
VVDTNGEDSNGKGEESMWPKLFVTLSSKEKEEDFMAMKGCKPSHRPKKRAKLIQKSLLLVSPGTWLADMCPDRYDVTVKK
SSKKRRARGLKAMGNNIESDSD*

DNA
ATGTCGTCGTTAGAACAAGAAATGTTCTTACAGTGGGGAAACAAGAAGAGAATGAGACGCCTAAGAGCCTCCGCCAACAA
GGACACCAAACACATCTCGCAACGCCAATCTAACTCTTCATCTCACGAGACCTTCCTCTTTCATTCCTCAAGATTCTCCA
GAGGATCAGAAGGTGCAATACTCAGATCCGGACCACCGCCAGAGAAAGAGAAAGAGGAGAGGTATTACACTACGAGAGGC
GTTGTTGATACCAACGGAGAAGACAGCAACGGCAAGGGAGAGGAGAGCATGTGGCCGAAGCTGTTTGTGACGCTGTCGAG
CAAAGAGAAGGAAGAAGACTTCATGGCTATGAAAGGCTGTAAACCTTCGCATAGGCCTAAGAAGAGAGCCAAACTCATCC
AAAAAAGCTTACTCTTGGTGAGTCCTGGAACATGGTTGGCTGATATGTGTCCGGATAGATACGATGTTACGGTCAAGAAG
AGCTCTAAGAAGAGGAGAGCAAGAGGATTAAAAGCAATGGGGAATAATATTGAGAGCGATTCAGATTGA