Details for Kale Locus Bo5g148580

Position : C5 ( 5`- 45863188 .. 45865531 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148580

Protein [Map View]
MKSVVAHFSTPLITGARFFSPTCLIQRQSISTVRCRKSSSSLTVMASAAQSSSQAVSPGNASGETDVFKMIQAHEAKAAR
LSRVEEIRTVLNGSVCGMLSTFSQKYEGYPSGSMVDFACDADGSPILAVSSLAVHTKNLLANPKCSLLVARDPEDRTGLR
ITLHGDAVLVSDNDQAAVRSAYLAKHPNAFWVDFGDFSFMRIEPKVVRFVSGVATAFLGSGEFSKEEYQAAKVDPIAQFA
KPVTSHMNKDHEEDTIAIVHHATSIPVESALMLDLDSLGFNVKATLQGNTFKIRVPFPRRAQDRKDVKTLIVEMLQAAKS
VSN*

DNA
ATGAAGTCGGTGGTTGCTCATTTCTCAACGCCTTTAATCACAGGAGCTAGATTCTTCTCTCCTACATGTCTTATTCAACG
GCAATCGATCTCCACCGTCCGCTGTAGAAAGTCTTCCTCCTCTCTCACCGTGATGGCCTCAGCAGCTCAGTCTTCTTCTC
AGGCTGTATCACCAGGGAATGCTAGCGGTGAGACGGATGTTTTCAAAATGATTCAAGCTCACGAGGCGAAGGCTGCTCGT
CTTTCTCGTGTTGAGGAAATAAGAACTGTGCTTAACGGTAGTGTTTGTGGTATGCTTTCCACTTTTTCTCAGAAGTATGA
GGGTTATCCGTCAGGATCTATGGTTGATTTTGCATGTGATGCTGATGGTTCTCCGATTCTAGCAGTTAGTAGCTTGGCTG
TCCATACAAAGAATCTATTAGCTAATCCAAAATGCTCACTACTGGTTGCTAGAGACCCGGAGGACAGGACCGGTTTGAGG
ATCACCCTACATGGTGATGCTGTGTTGGTTTCTGACAATGACCAAGCGGCTGTTCGATCTGCCTATTTAGCCAAGCATCC
CAATGCTTTCTGGGTTGATTTTGGGGACTTCAGCTTTATGAGGATTGAACCAAAAGTTGTCAGATTTGTTTCAGGGGTTG
CAACTGCTTTTCTAGGATCTGGAGAATTCAGCAAAGAGGAGTACCAAGCAGCCAAAGTAGATCCTATAGCTCAGTTTGCA
AAGCCTGTAACGTCACACATGAACAAAGACCATGAAGAGGATACCATAGCCATTGTACACCATGCAACATCCATACCTGT
GGAGAGCGCCTTGATGCTGGATTTGGACAGCCTTGGTTTCAATGTGAAGGCTACTCTTCAAGGGAACACCTTCAAGATCC
GAGTTCCCTTCCCAAGACGCGCTCAAGACAGAAAGGATGTGAAGACACTGATAGTGGAAATGCTTCAAGCTGCCAAGTCT
GTTTCCAATTAG