Details for Kale Locus Bo5g148550

Position : C5 ( 5`- 45857682 .. 45859694 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148550

Protein [Map View]
MKHIYTNTNTKFVGISLYIYTHLQYQESHFSVAFLSKSNKPKNKNTMNALAATNRNFKLASRLLGLDSKLEQSLLIPFRE
IKVECTIPKDDGTLASFIGFRVQHDNARGPMKGGIRYHPEVEPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSELSI
SELERLTRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGHSPAIVTGKPIDLGGSLGRDAATGRGVLFATE
ALLNEHGKSIAGQRFVIQGFGNVGSWAAKLINEKGGKIVAVSDVTGAIKNKNGIDISGLIEHTEENIGVKGFDGADAIDP
DSVLVEDCDILIPAALGGVIHRENANEIKAKFVIEGANHPTDPEADEILRKKGVVILPDIYANSGGVIVSYFEWVQNIQG
FMWDEEKVNKELKSYMTRGFKDLKEMCKTHSCDLRMGAFSLGVNRVAQATVIRGWGS*

DNA
ATGAAGCATATATACACTAACACAAACACGAAGTTTGTAGGTATCTCTCTCTATATATATACACACTTGCAATACCAAGA
ATCACATTTTTCAGTAGCTTTCTTATCAAAGTCGAATAAACCAAAAAATAAGAACACCATGAACGCTTTAGCAGCAACCA
ACAGAAACTTCAAGCTAGCTTCTAGGCTTCTTGGTTTGGACTCAAAGCTCGAGCAAAGTCTTCTCATTCCCTTCAGAGAA
ATCAAGGTGGAATGTACCATACCGAAAGACGATGGAACTCTTGCATCATTCATTGGATTCAGAGTCCAACACGACAATGC
AAGAGGTCCCATGAAAGGTGGCATCAGATATCATCCAGAGGTGGAACCGGATGAAGTAAACGCATTGGCTCAACTCATGA
CATGGAAAACAGCTGTGGCTAAAATACCTTACGGTGGAGCCAAAGGAGGGATTGGTTGTGACCCGAGCGAGCTAAGCATC
TCAGAGCTCGAACGTTTGACTCGAGTTTTCACACAAAAAATCCATGACCTCATTGGTATTCATACCGATGTTCCTGCTCC
TGATATGGGAACCGGTCCTCAGACAATGGCGTGGATTCTTGATGAATACTCGAAATTTCACGGACACTCTCCTGCTATTG
TGACCGGCAAACCAATTGATCTTGGTGGATCTCTTGGGAGAGATGCTGCCACAGGAAGAGGAGTGTTGTTCGCAACAGAA
GCTCTACTCAACGAACATGGAAAGAGCATAGCTGGACAGAGATTCGTCATCCAGGGTTTTGGGAATGTGGGTTCTTGGGC
GGCGAAGTTGATAAATGAAAAGGGAGGGAAGATTGTGGCGGTGAGCGACGTCACAGGAGCAATCAAGAACAAGAATGGAA
TCGATATCTCTGGTTTGATCGAGCATACCGAAGAAAACATAGGAGTCAAAGGGTTTGATGGTGCTGATGCTATCGATCCT
GATTCAGTTCTTGTTGAAGATTGTGATATCTTGATCCCCGCAGCCCTAGGTGGCGTCATCCACAGGGAAAATGCTAATGA
GATTAAAGCAAAGTTCGTCATTGAAGGTGCTAATCACCCAACTGATCCTGAAGCTGACGAGATATTGAGGAAGAAAGGTG
TTGTGATTCTTCCAGACATATACGCAAACTCAGGAGGAGTCATTGTAAGTTACTTCGAATGGGTTCAGAACATACAAGGA
TTCATGTGGGATGAGGAAAAGGTGAACAAGGAGCTAAAGAGTTACATGACTCGCGGCTTCAAAGATTTGAAAGAGATGTG
TAAGACTCACTCATGTGATCTCCGTATGGGAGCTTTCTCCCTAGGTGTTAACCGTGTGGCTCAAGCTACCGTTATCAGAG
GCTGGGGATCATGA