Details for Kale Locus Bo5g148530

Position : C5 ( 5`- 45823945 .. 45826783 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148530

Protein [Map View]
MGFRPKVALKLEHRNSKGCNFGPPYEWQVYNTLNSCYGIPAVHHKGRQGDFYILVMDMLGPSLWDVWNSLAQSMSPNMVA
CIAVEAISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDSHSGQHVEYDQRPDVFRGTIRYASCH
AHLGRTGSRRDDLESLAYTLIFLMRGRLPWQGYQGDNKSFLVCKKKMSTSPELMCCFCPPPFKLFLEAVTNMKFDEEPNY
AKLISIFDTLIEPCAISRPIRIDGALKVGQKRGRLLINLEEDEQPRKKIRIGSPATQWISVYNARRPMKQRYHYNVAETR
LPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKG
TPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAA
TADQAALILSIPKRKLTDETQETLRTSAFPSTHIKEKWAKNLYIASICYGRTVC*

DNA
ATGGGGTTTAGACCAAAAGTAGCTCTGAAGCTTGAACACCGGAATAGTAAAGGATGCAATTTTGGCCCACCTTACGAGTG
GCAAGTGTACAATACGCTCAATAGCTGTTATGGAATTCCTGCTGTACATCATAAGGGTCGTCAAGGAGATTTTTACATCC
TGGTCATGGACATGCTTGGTCCTAGCCTTTGGGATGTTTGGAATTCTTTAGCTCAGTCGATGTCTCCAAACATGGTAGCG
TGCATTGCAGTGGAGGCCATATCTATTCTTGAGAAACTGCATATGAAGGGGTTTGTGCATGGAGATGTGAAACCGGAAAA
CTTTTTACTTGGTCAGCCTGGAACAGCAGACGAGAAGAAACTGTACCTTATCGATCTTGGCCTAGCATCAAGATGGAAAG
ATTCGCACTCTGGCCAGCATGTTGAATATGATCAAAGACCTGATGTATTCAGGGGAACGATACGTTATGCAAGTTGTCAT
GCACATCTTGGTCGTACTGGAAGTAGGAGAGATGATCTAGAGTCACTGGCTTACACATTGATATTTCTGATGCGGGGGAG
GTTGCCATGGCAAGGGTATCAGGGTGACAACAAGAGCTTTCTTGTTTGCAAGAAAAAGATGTCAACCTCTCCTGAACTGA
TGTGCTGTTTCTGTCCTCCCCCGTTCAAGCTTTTCCTCGAGGCAGTTACCAACATGAAGTTTGACGAGGAGCCTAACTAC
GCCAAGCTTATCTCGATTTTTGATACTCTCATCGAGCCATGTGCTATATCTAGACCGATTAGAATTGATGGGGCTCTGAA
GGTTGGCCAAAAACGAGGAAGATTGCTTATCAATTTGGAAGAGGATGAACAGCCGAGGAAGAAAATCAGAATCGGCAGTC
CTGCTACTCAGTGGATCTCAGTCTATAATGCACGTCGTCCTATGAAACAGAGATATCATTACAATGTTGCGGAGACAAGG
CTGCCTCAGCATGTGGAGAAAGGTAACGAGGATGGCCTTTACATCAGCTGTGTAGCATCAGCAGCTAATCTCTGGGCTCT
TATCATGGATGCTGGGACTGGGTTCAGCTCTCAAGTCTATGAATTGTCCACAGTCTTCTTGCACAAGGACTGGATCATGG
AACAATGGGAAAAGAACTACTATATCAGTTCCATAGCTGGTGCTAACAACGGAAGCTCGTTGGTCGTTATGTCGAAAGGA
ACTCCTTATACCCAGCAATCTTACAAAGTCAGCGACTCATTCCCATTCAAATGGATAAACAAAAAGTGGAAAGAAGGATT
TCATGTAACCTCCATGACCACTGCTGGGAGTCGTTGGGGTATAGTAATGTCCAGAAACTCAGGCTATTCCGAACAGGTGG
TGGAGCTCGATTTTTTGTACCCAAGTGAAGGAATCCATAGAAGATGGGAGAGTGGATTCAGGATAACATCAATGGCTGCA
ACAGCAGATCAAGCTGCTCTCATATTGAGTATACCCAAACGAAAATTAACTGATGAAACCCAAGAGACTCTTCGCACTTC
TGCTTTCCCAAGCACCCATATCAAGGAAAAATGGGCGAAAAATCTGTACATTGCATCAATATGCTATGGTCGGACCGTTT
GCTGA