Details for Kale Locus Bo5g148510

Position : C5 ( 5`- 45815362 .. 45817503 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148510

Protein [Map View]
MAGASSSSDSFPLETSDWFQELSLGSDASEAPRNHYKGSLQQHYGHVPCGAYTAPSSHGSERKPNLNVGNVINGGDPFGS
YPWGYYPSGGYQDQSFGYGHNNNSNTFSHLMMDPHNSSFDQFGYNDHLYSNQGLYGLYGNVIDSGHAYGTFGYDSWKLGR
DWYPVDGYRKSRSFNYGRGYSEEKADRLNELCRGPRSSEGLSSTTKQDAPMAVDLHRYNGENFPETFTKEKFFVIKSYSE
DDVHNSIKHGVWSSTPTGNKKLNAAYYEAQESCCPVYLLFSVNASGQFVGVAEMTGPVDFNKTVEYWQQDKWIGCFPVKW
RIIKDVPNSFLRHVTIANNENKPVTNSRDTQEVNVEDGAKIIKIFKEYMSKTCILDDFKFYETRQKMIRDKKIKQKKQVL
DVASVETIH*

DNA
ATGGCTGGGGCCTCCTCTTCTTCTGATAGCTTCCCTCTGGAAACATCAGATTGGTTCCAGGAGTTGTCTTTAGGTTCAGA
TGCAAGTGAAGCCCCTAGGAACCATTATAAGGGTTCTCTTCAGCAACACTATGGACATGTACCTTGTGGTGCATATACTG
CTCCATCTTCTCATGGAAGCGAAAGAAAGCCTAATCTTAATGTTGGAAACGTGATAAATGGCGGAGACCCGTTTGGTTCA
TACCCGTGGGGTTACTATCCTTCTGGTGGCTACCAGGATCAGAGTTTTGGTTATGGCCACAACAACAATTCAAATACCTT
TTCACATCTCATGATGGATCCACACAATTCAAGTTTTGACCAGTTTGGATATAATGATCATTTGTATTCAAACCAAGGAC
TGTATGGACTTTACGGTAACGTAATCGACTCTGGTCATGCTTATGGAACGTTTGGTTATGACTCTTGGAAGCTCGGGAGA
GATTGGTATCCTGTTGATGGCTATAGAAAGTCCAGAAGCTTCAACTACGGACGTGGCTACAGCGAAGAGAAAGCAGATAG
GCTTAACGAGCTTTGTAGAGGACCAAGAAGCAGTGAAGGTCTCAGCTCTACAACGAAGCAAGACGCTCCAATGGCAGTAG
ATCTCCATCGCTACAACGGAGAGAACTTCCCTGAAACATTCACCAAAGAGAAGTTCTTTGTGATCAAGTCATACAGCGAA
GACGATGTCCACAACAGTATCAAGCATGGCGTGTGGTCCAGCACACCAACTGGCAACAAGAAGTTGAACGCTGCGTATTA
CGAAGCCCAAGAGAGTTGTTGTCCTGTTTATCTCCTCTTCTCGGTGAATGCAAGTGGGCAGTTCGTTGGTGTTGCGGAGA
TGACAGGTCCTGTTGATTTCAACAAGACGGTGGAGTATTGGCAACAAGATAAATGGATTGGTTGCTTCCCTGTGAAGTGG
CGTATCATCAAAGACGTACCGAACAGTTTCTTGAGGCACGTAACGATTGCTAATAACGAGAACAAGCCCGTTACTAACAG
CAGAGACACTCAAGAGGTGAATGTGGAAGATGGAGCCAAAATCATAAAGATATTCAAGGAGTATATGAGCAAGACATGTA
TACTTGATGACTTCAAGTTTTATGAGACCAGACAAAAGATGATCAGAGATAAGAAGATCAAGCAAAAGAAACAGGTCCTT
GATGTAGCTTCTGTAGAAACGATCCACTGA