Details for Kale Locus Bo5g148500

Position : C5 ( 5`- 45811386 .. 45814680 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148500

Protein [Map View]
MQPYGIQSMLKDGYRHLSGLDEAVIKNIEACKELSTITRTSLGPNGMNKMVINHLDKLFVTNDAGTIVNELEIQHPAAKI
LVLAAKAQQEEIGDGANLTISFAGELLQNAGALIRAGLHPSDIITGYNKAITKTVEILEQLVESGSETMDVRNKDEVVFR
MRAAVASKQFGQEEIICSLVADACIQVCPKNPTNFNVDNVRVAKLLGGGLHNSCIVRGMVLKSDAVGSIKRMEKAKVAVF
AGGVDTNATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKIMVLKISSKFELR
RFCRTAGAVAHLKLSRPSPDDLGYVDSIAVEEIGGVTVTIARNEQGGNSISAVVLRGSTDSILDDLERAVDDGVNTYMAM
CRDSRIVPGAAATEIELAQRLKEYANAETGLHSHAILKYAESFQFVPQTLADNAGLDAMEIIASLYTGHGSGNTKLGIDL
EEGACKDVSETKVWDLFATKLFALKYASDAACTVLRVDQIIMAKQAGGPRRDLAAAAGAGAEED*

DNA
ATGCAGCCTTATGGAATCCAGTCGATGCTCAAGGATGGTTACAGACATCTCTCTGGTCTAGACGAGGCCGTCATAAAAAA
CATCGAAGCTTGCAAAGAGCTCTCTACCATCACCCGCACTTCTCTCGGCCCCAATGGGATGAACAAGATGGTTATAAACC
ATTTAGACAAGCTCTTCGTCACAAACGACGCTGGTACCATTGTGAATGAGCTGGAGATTCAGCACCCTGCCGCGAAGATC
CTTGTCTTAGCTGCCAAGGCTCAGCAAGAAGAGATCGGAGACGGAGCCAATCTGACAATCTCCTTTGCTGGTGAGCTTCT
GCAAAATGCTGGAGCGCTTATCAGGGCGGGACTGCATCCAAGTGATATCATTACTGGATATAACAAAGCAATCACTAAGA
CTGTTGAGATTTTGGAGCAACTGGTTGAGAGTGGTTCTGAGACAATGGATGTGCGTAACAAAGATGAAGTGGTGTTTAGG
ATGAGAGCTGCTGTTGCTAGCAAGCAGTTTGGTCAAGAAGAGATTATATGCTCTCTCGTTGCTGATGCTTGCATTCAAGT
CTGCCCAAAAAATCCAACAAACTTCAATGTAGATAACGTCCGTGTTGCCAAGCTATTGGGAGGAGGGTTGCACAACTCTT
GCATAGTCCGTGGAATGGTCTTGAAAAGTGACGCTGTGGGTAGCATCAAACGAATGGAGAAGGCAAAGGTTGCGGTGTTT
GCTGGGGGAGTTGATACTAATGCAACAGAGACAAAAGGAACTGTGTTGATCCATAGTGCTGAGCAGCTAGAGAACTATGC
AAAGACAGAGGAAGCTAAAGTTGAGGAGCTGATTAAAGCTGTAGCTGAATCAGGAGCCAAAGTGATTGTTAGTGGGGGAT
CAGTTGGAGAGATGGCATTACATTTTTGTGAGCGTTACAAGATAATGGTTTTGAAAATCAGCTCAAAGTTTGAACTGAGG
CGTTTCTGCCGCACAGCTGGGGCTGTTGCTCATTTGAAACTAAGCCGACCAAGTCCTGATGATTTGGGATACGTTGATTC
CATAGCAGTGGAGGAGATTGGTGGTGTGACAGTCACTATTGCAAGAAATGAGCAAGGTGGTAACTCAATCTCCGCAGTGG
TTTTGCGTGGAAGCACAGATAGTATTTTGGACGACCTTGAAAGAGCTGTTGACGATGGAGTCAATACATACATGGCCATG
TGCAGGGACAGCCGTATCGTTCCCGGGGCTGCAGCTACCGAAATAGAACTGGCTCAGAGGTTGAAGGAATACGCCAATGC
AGAAACAGGGTTGCACAGTCATGCTATCCTCAAATACGCAGAGAGCTTCCAGTTTGTACCCCAAACCCTTGCTGACAACG
CTGGCCTCGATGCGATGGAAATCATTGCTTCTCTGTACACTGGACACGGGTCTGGAAACACAAAGCTAGGCATTGACTTG
GAGGAAGGTGCTTGTAAAGATGTCTCAGAGACTAAAGTGTGGGATCTTTTTGCAACCAAGTTATTTGCTCTTAAGTATGC
TTCTGATGCTGCATGCACGGTGCTTCGCGTAGACCAGATTATAATGGCGAAACAAGCAGGTGGACCAAGGAGAGACTTAG
CAGCAGCCGCAGGTGCAGGCGCAGAGGAAGACTAA