Details for Kale Locus Bo5g148450

Position : C5 ( 5`- 45794107 .. 45796137 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148450

Protein [Map View]
MLNIPSVKQAIEEAFRRTVGERKMKGSKANLSTLAEKCKTIIVSNWKGYLNTIKPEDKASIIHTSKVKYVMRRGKPYLWV
PESEPHNVNIMFDERGSFSVSHPYPGPLAALLKSIGKVPNRVALTGEIIPVKEKRIEAVNKYVEEAIQSEMRAISDSPYS
VRSILSSSDQMYASRCESLKALVDGGNEKYVIYKFVPSSCMFIDGNGANKEIDLKVLELSKADPLGAWSTNLVDGINKNE
SRRRALILFCLYYLDINARDAYMVSLDIKGFDLLGKVPGEEEGGDEYQWREFRFEFEEETKDVEAFCHQLVEMEQEVVNK
FTDHTGL*

DNA
ATGCTGAATATCCCCTCGGTCAAACAGGCGATCGAAGAGGCATTCCGTCGAACAGTTGGTGAGCGCAAAATGAAAGGAAG
CAAGGCGAATCTATCTACACTAGCGGAGAAATGCAAAACTATAATCGTTTCGAACTGGAAAGGGTATCTAAACACCATCA
AACCTGAAGATAAAGCTAGTATCATACATACTTCAAAGGTTAAGTACGTGATGAGACGAGGAAAGCCTTATCTCTGGGTA
CCTGAATCTGAACCCCACAATGTCAACATAATGTTTGATGAACGTGGATCCTTCTCCGTTTCTCATCCCTATCCTGGTCC
CCTCGCAGCTTTGTTGAAGTCAATAGGAAAGGTTCCAAACCGGGTTGCTCTTACTGGAGAAATCATCCCTGTCAAAGAGA
AAAGGATTGAGGCGGTGAATAAATATGTGGAGGAAGCTATACAATCAGAGATGAGAGCGATTAGTGACTCCCCATACTCG
GTCCGCAGTATCTTGAGTTCTTCCGACCAGATGTATGCCTCCCGGTGCGAGAGTCTTAAAGCCCTGGTCGATGGTGGCAA
TGAGAAATACGTTATCTACAAGTTTGTTCCCAGCTCATGTATGTTTATCGATGGAAATGGTGCTAATAAAGAAATAGACT
TGAAGGTCTTGGAGCTATCAAAAGCAGATCCATTAGGGGCCTGGTCTACAAATCTTGTGGATGGAATCAACAAGAACGAA
TCGAGAAGACGGGCTTTGATTCTTTTCTGCTTATACTATCTCGATATCAACGCAAGGGATGCTTACATGGTATCTCTGGA
TATTAAAGGCTTCGACTTGCTGGGGAAGGTACCGGGTGAGGAAGAAGGTGGAGATGAGTATCAGTGGAGAGAGTTTAGGT
TTGAGTTTGAAGAAGAGACGAAAGACGTTGAAGCTTTTTGCCACCAGCTTGTGGAAATGGAACAAGAGGTTGTGAACAAG
TTCACTGACCATACCGGTTTGTAA