Details for Kale Locus Bo5g148430

Position : C5 ( 5`- 45774930 .. 45776334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148430

Protein [Map View]
MVEEVGAFVNQGGDNEVVDLPPGFRFHPTDEEIITHYLKEKVFNVQFTSAAIGQADLNKNEPWDLPKIAKMGEKEFYFFC
QRDRKYPTGMRTNRATLSGYWKATGKDKEIFRGKACIVGMKKTLVFYRGRAPKGEKTNWVMHEYRLDGIYSYHNLPKSSR
DEWVVCRVFHKNAPPLTITTTTTTNQLIRIESLDNIDHLLDVSSLPPLIDPGFLGQPGPSFSGAGQRQDLKHILHYPTTA
AVDNTYLPEQIVNYPYHSVPNPGSGSGYGTGSGNNSNRMIKLERSLVSVSQETGLSSDVNTTATPETSSYLMMGSSVANA
AMMDGNNTSYDDDLGIFWDDYKLI*

DNA
ATGGTGGAAGAAGTAGGTGCATTTGTGAACCAAGGAGGAGATAATGAGGTGGTGGATTTGCCTCCGGGGTTTCGGTTTCA
TCCAACTGATGAAGAGATCATAACTCACTACCTTAAAGAGAAAGTCTTCAACGTCCAGTTCACCTCGGCTGCAATTGGTC
AAGCCGACCTTAACAAGAACGAGCCTTGGGATCTACCAAAAATTGCAAAGATGGGAGAGAAGGAGTTTTACTTTTTTTGC
CAGCGGGATAGGAAGTACCCGACCGGCATGAGGACGAACCGTGCAACCCTGTCCGGTTACTGGAAGGCAACCGGGAAGGA
CAAGGAGATCTTTAGGGGCAAAGCTTGTATTGTTGGGATGAAGAAAACACTTGTGTTCTATAGAGGAAGAGCTCCGAAAG
GTGAAAAGACCAATTGGGTTATGCATGAGTATCGTCTTGATGGCATATATTCTTATCACAATCTCCCTAAATCTTCAAGG
GATGAATGGGTGGTGTGTAGGGTTTTCCACAAGAACGCTCCTCCTCTCACTATTACTACTACTACTACTACAAATCAACT
CATAAGGATTGAATCTCTTGACAACATTGATCATCTCTTAGACGTCTCTTCTCTCCCTCCTCTCATCGATCCCGGTTTCT
TGGGTCAACCCGGTCCAAGCTTCTCAGGTGCCGGCCAACGACAAGACCTCAAGCACATCCTCCATTACCCTACAACCGCG
GCGGTCGACAACACTTACCTCCCTGAACAAATCGTCAATTACCCTTACCACTCGGTCCCAAATCCTGGATCTGGTTCGGG
TTACGGGACTGGCTCGGGAAATAATAGTAACCGTATGATCAAGTTGGAGCGTTCTCTTGTGAGTGTGTCTCAAGAAACCG
GTTTAAGTTCCGACGTGAACACAACCGCGACGCCAGAGACATCTTCGTATCTAATGATGGGGTCTTCGGTGGCCAATGCG
GCAATGATGGATGGTAACAACACGTCGTATGATGATGACTTGGGGATCTTTTGGGACGACTACAAACTAATTTGA