Details for Kale Locus Bo5g148400

Position : C5 ( 5`- 45757942 .. 45759489 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148400

Protein [Map View]
MGVVKSAIGDMLMTFSWVVLSATFGLQTTEIISAAGFQGIAWAPLAITTFLIFVYVSIFTVVFGSASFNPTGNAAFYAAG
VPGDTLFTLAIRLPAQAAGAAGGALAIMEFIPEKYKHMISGPSLQVDVHTGAIAETILSFGITFAALLIIIRGPRRLLAK
TFLLALATICFVVAGSKYTGPAMNPAIAFGWAYMYSSHNTWDHFYVYWISSFVGALSAALVFRTIFPPHKPQQKKQKKA*

DNA
ATGGGCGTTGTGAAGTCAGCGATTGGGGATATGCTGATGACCTTCTCCTGGGTCGTCCTCTCCGCGACCTTCGGTTTACA
AACGACGGAAATCATCTCCGCCGCCGGTTTTCAGGGAATCGCTTGGGCTCCGTTGGCCATCACCACGTTTCTGATTTTCG
TCTACGTTTCCATTTTCACCGTTGTCTTCGGTAGCGCTAGCTTTAATCCTACCGGAAACGCCGCCTTTTATGCCGCCGGT
GTCCCCGGAGACACCCTTTTCACCTTGGCGATCAGGTTACCTGCTCAGGCAGCTGGTGCGGCAGGAGGTGCACTAGCCAT
CATGGAGTTCATACCAGAGAAGTACAAGCATATGATATCAGGACCTTCCCTTCAGGTTGATGTGCACACCGGAGCTATTG
CAGAAACCATCTTAAGTTTCGGTATTACCTTTGCGGCTTTGCTTATTATCATCAGGGGTCCACGGAGATTACTCGCCAAG
ACCTTCTTGCTCGCTCTCGCCACCATTTGCTTCGTTGTTGCTGGCTCTAAATACACCGGACCAGCCATGAATCCCGCCAT
TGCGTTTGGGTGGGCATATATGTACAGCTCTCACAACACATGGGACCATTTCTACGTGTACTGGATCAGTTCTTTCGTTG
GAGCTTTATCTGCTGCGTTGGTCTTCCGTACTATCTTCCCACCACATAAACCCCAGCAGAAGAAACAGAAGAAAGCCTGA