Details for Kale Locus Bo5g148390

Position : C5 ( 5`- 45756344 .. 45756925 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148390

Protein [Map View]
MKFTKGKQKIEMKKVGAYAARMIMFSKRKSGLFKKMNEIVSLCNVETSFLVFSDSGKPYTFAYPSLKEAVGQFKNPLRDE
PSATINTGPLVEAYRRQKNQDLMERYMDLVEELEIKNEKERILKKIIKENKEKILWNIPPAEGLSVEEKKWMRQTFVDLH
VYLGDMALKCFGNDGDRSSSSQESYGRDGETYA*

DNA
ATGAAGTTTACAAAGGGAAAGCAAAAGATCGAGATGAAGAAGGTTGGAGCCTATGCAGCCCGAATGATTATGTTCTCGAA
ACGTAAATCTGGACTCTTCAAGAAGATGAACGAGATCGTTTCACTATGCAATGTGGAGACGAGTTTTTTGGTCTTTTCTG
ATTCCGGAAAGCCTTACACATTCGCATATCCGTCTCTGAAAGAAGCGGTTGGCCAGTTTAAAAACCCTTTAAGAGATGAA
CCATCCGCAACTATCAATACCGGACCGCTGGTGGAAGCTTATAGGAGACAGAAGAACCAGGACCTCATGGAAAGGTACAT
GGATCTCGTTGAGGAGCTTGAAATAAAGAATGAGAAGGAAAGGATTTTGAAGAAAATTATAAAGGAAAATAAGGAGAAAA
TATTGTGGAATATTCCTCCGGCCGAAGGTTTGAGCGTGGAAGAGAAGAAGTGGATGCGCCAAACGTTTGTAGATTTACAT
GTTTACTTGGGCGATATGGCCTTGAAATGTTTTGGAAATGACGGTGACCGTTCATCTTCTAGTCAAGAGAGTTATGGTCG
TGATGGCGAAACCTATGCATGA