Details for Kale Locus Bo5g148380

Position : C5 ( 5`- 45692261 .. 45694298 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148380

Protein [Map View]
MAGGKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKPVTV
FGIRNPEDIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNC
LAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPQLNGKLTGMSFRVP
TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDN
EWGYSTRVVDLIVHMSKC*

DNA
ATGGCTGGCGGTAAGATCAAGATCGGAATCAACGGATTCGGAAGAATCGGTCGTTTGGTAGCTAGAGTTGTTCTCCAGAG
GGACGATGTTGAGCTCGTTGCGGTTAACGATCCCTTCATCACCACTGAGTACATGACCTACATGTTCAAGTACGACAGTG
TTCACGGTCAATGGAAACACCATGAGCTCAAGGTCAAGGATGAGAAGACTCTTCTCTTCGGTGAGAAGCCGGTCACCGTC
TTCGGCATCAGGAACCCTGAGGATATCCCATGGGCTGAGGCTGGAGCCGACTTCGTTGTTGAGTCTACTGGTGTTTTCAC
TGACAAGGACAAAGCTGCTGCTCACTTGAAGGGTGGTGCCAAGAAGGTTGTCATCTCTGCCCCTAGCAAGGACGCGCCCA
TGTTTGTCGTTGGTGTCAACGAGCACGAGTACAAGTCCGACCTTGACATTGTCTCCAACGCTAGTTGCACCACTAACTGC
CTTGCTCCCCTTGCCAAGGTTATCAACGACAGGTTCGGCATTGTTGAGGGTCTTATGACCACCGTCCACTCCATCACTGC
TACTCAGAAGACTGTTGATGGACCATCAATGAAGGACTGGAGAGGTGGAAGAGCTGCTTCATTCAACATCATTCCCAGCA
GCACCGGAGCTGCCAAGGCCGTCGGAAAGGTGCTTCCACAGCTCAACGGAAAGTTGACCGGAATGTCCTTCCGTGTCCCC
ACCGTTGACGTCTCAGTTGTTGACCTCACGGTTAGACTCGAGAAAGCTGCAACCTACGACGAGATCAAGAAGGCTATCAA
GGAGGAATCAGAAGGCAAGCTAAAGGGAATCCTTGGCTACACCGAGGATGATGTCGTCTCAACTGACTTCGTTGGTGACA
GCAGGTCGAGCATTTTCGATGCCAAGGCTGGAATCGCATTGAGTGACAACTTCGTGAAGCTGGTGTCGTGGTATGACAAC
GAATGGGGTTACAGTACCCGTGTGGTCGACTTGATCGTCCACATGTCAAAGTGCTAA