Details for Kale Locus Bo5g148370

Position : C5 ( 5`- 45688913 .. 45690424 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148370

Protein [Map View]
MSRLIQNRIKNTFSRLKPSIALSSSTLIKNLSTSPEPSPEPLDESSEIWNVIIGRAGGDRVVSEDEVFHRLSNDPFCNRV
NLSDTLLNKLLHRFRDDWRSALGVLKWAESRKAHHHKHSPEAYDLAVDILGKAKKWDRMKEFVQKMSEDKAVTLNTVAKI
MRRFAGAGEWEEAVNVFDRLNEFGLEKNTESMNLLLDTLCKEKRVERARSVLLELKAHIKPDSHTFNIFINGWCKTNRVE
EALWTIQEMRGYGFRPCVISYTTIIKCYCLQCDFIKVYEMLSLMEANDSPPNSVTYTTIMSCLNSQKEFEESLRVAARMK
RSGIEADTLFYNCLIHTLARAGRVEEAERVFREEMPSVNTSTYNSMIAMYCHHDEEVKAVELLREMEGLKVCEPDVHTYH
PLLRSCFKRGDVVEVGRLLKEMVTKHHLSLDESTYTFLIQRFCTADMCEWAYCLFEEMISQDIAPRHRTCLLLLEEVRKK
NMLEAVERIEHVMRTVKLTAPVK*

DNA
ATGTCTCGTCTCATTCAAAACCGCATTAAAAACACTTTCTCACGCCTCAAGCCTTCCATCGCTCTCTCCTCATCTACCCT
CATCAAGAATCTCTCCACGTCTCCAGAGCCATCACCCGAACCACTCGACGAATCCTCGGAGATATGGAACGTCATCATAG
GCCGAGCAGGCGGCGACAGAGTCGTCAGCGAAGACGAAGTCTTCCACCGCCTCTCAAACGATCCCTTCTGCAACAGAGTA
AACCTCTCAGACACTCTACTCAACAAGCTCCTCCACAGGTTCAGAGACGACTGGAGATCAGCTCTCGGCGTCTTGAAATG
GGCCGAGTCTCGCAAAGCCCACCACCACAAGCACTCACCCGAGGCTTACGACTTGGCGGTGGATATACTCGGGAAAGCCA
AGAAATGGGATCGTATGAAGGAGTTCGTTCAGAAGATGAGTGAAGATAAAGCCGTGACGTTAAACACTGTGGCCAAGATC
ATGAGGAGGTTCGCTGGAGCTGGTGAGTGGGAAGAAGCTGTTAACGTGTTTGATAGGTTAAACGAGTTTGGATTAGAGAA
GAACACCGAGTCTATGAACTTGCTGTTAGATACTCTCTGTAAGGAGAAGAGAGTCGAGCGAGCTAGATCTGTTTTATTAG
AGCTAAAGGCTCACATTAAGCCTGATTCTCATACTTTTAATATCTTTATTAACGGTTGGTGTAAGACCAATAGAGTCGAG
GAGGCTCTCTGGACTATCCAAGAGATGAGAGGTTATGGGTTCCGTCCTTGTGTGATTAGCTACACGACGATTATAAAATG
TTATTGTTTGCAGTGTGACTTTATTAAAGTGTATGAGATGTTGAGTTTGATGGAAGCTAACGATTCTCCTCCGAACTCTG
TTACCTACACGACGATAATGTCTTGTCTTAATTCGCAGAAAGAGTTTGAGGAGTCTTTGAGGGTAGCTGCGAGGATGAAA
CGGTCTGGTATTGAGGCGGATACTCTTTTCTATAACTGTTTGATTCACACGCTTGCTCGAGCCGGGAGGGTGGAAGAAGC
TGAGAGGGTTTTCAGAGAAGAGATGCCTTCCGTTAACACATCTACTTATAACTCGATGATTGCTATGTATTGTCACCACG
ACGAGGAGGTTAAGGCCGTTGAGCTTCTCAGGGAGATGGAGGGTTTGAAGGTTTGTGAGCCTGATGTTCACACGTATCAT
CCTTTGCTGAGGTCTTGCTTTAAGAGGGGAGATGTGGTTGAGGTTGGGAGGTTGTTGAAAGAAATGGTGACTAAGCATCA
TTTGAGCTTGGATGAGTCGACTTATACTTTTTTGATTCAGAGGTTTTGTACAGCTGATATGTGTGAGTGGGCGTATTGTC
TATTTGAGGAGATGATTAGCCAAGATATCGCGCCGAGGCATAGGACTTGTTTGTTGCTATTGGAAGAGGTTAGGAAGAAG
AATATGCTTGAAGCGGTTGAGAGGATTGAGCATGTGATGAGGACTGTTAAACTTACTGCCCCTGTAAAGTGA