Details for Kale Locus Bo5g148340

Position : C5 ( 5`- 45676683 .. 45678020 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148340

Protein [Map View]
MALSALPRHCKHHVFPSFHGKDVRRGFLSCLLKEFKEKGIDVFIDNDLERSKLIGPKLTEAIRGSLIAILLISRNYASST
WCLNELVEIMKCREEDKQTVEVIFYEVDPSDVKKQKGDFGAVFQKTCAEKSTEEVERWRQALQIVTQIAGYHTSNFDDDA
VMIETIVTDISNKFNDSTTSNDSNSLVGIGTHTKEIESLLSLESDEVRMVGIWGPSGIVRCPFDPNHLMPPEALVLHSLR
CPSTLNLTPLLGSFSSYRNTLELPCETELNNGDGDLCFSLDDVTDFFYNDCPGAVNFSDLDGKTRRFTLPTVLSVECSEL
EGSSVLEKSLFV*

DNA
ATGGCTCTTTCTGCTTTGCCTCGCCATTGTAAACACCATGTCTTTCCGAGCTTCCACGGGAAAGATGTCCGTAGAGGCTT
TCTCAGCTGCTTGCTGAAGGAGTTCAAAGAGAAAGGAATCGACGTCTTCATAGACAATGACTTAGAGAGGAGCAAGTTGA
TTGGTCCCAAGCTTACAGAAGCTATAAGAGGATCGTTAATTGCAATTCTCTTGATCTCGAGGAACTACGCTTCATCAACA
TGGTGTCTGAACGAGTTGGTGGAGATCATGAAGTGTAGGGAGGAAGATAAGCAGACGGTGGAGGTGATTTTCTATGAAGT
GGATCCATCTGACGTGAAAAAGCAGAAGGGAGATTTCGGAGCTGTCTTTCAGAAAACTTGTGCAGAAAAATCAACGGAGG
AAGTTGAGAGATGGAGACAAGCTTTGCAGATTGTGACTCAAATCGCTGGTTACCATACAAGTAACTTTGATGATGATGCA
GTCATGATTGAAACAATTGTTACCGATATTTCGAACAAGTTCAACGATTCTACAACATCAAATGATTCCAACAGCTTGGT
TGGGATTGGAACTCATACCAAGGAGATAGAGTCATTGTTGTCCTTAGAATCGGATGAAGTCCGGATGGTTGGTATCTGGG
GTCCTTCTGGAATTGTTCGGTGCCCTTTTGATCCAAATCACCTCATGCCACCGGAAGCTCTCGTCCTCCATTCACTTCGT
TGCCCAAGCACTCTCAATCTCACTCCTCTTCTCGGATCATTTAGTAGCTACAGAAACACGCTCGAGTTACCGTGTGAGAC
AGAGCTGAACAACGGCGACGGTGACCTCTGTTTCTCCTTAGATGACGTCACCGACTTCTTCTACAATGATTGCCCTGGCG
CTGTTAACTTCTCTGATCTCGATGGTAAAACGCGACGTTTTACACTTCCTACGGTTCTATCTGTGGAATGCAGCGAGCTT
GAAGGTTCTTCCGTGTTGGAGAAATCGTTGTTTGTGTGA