Details for Kale Locus Bo5g148300

Position : C5 ( 5`- 45660156 .. 45660697 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g148300

Protein [Map View]
MATKSMGDIEKIKKKLNVLIVDDDPLNLIIHEKIIKAIGGISQTANNGEEAVIIHRDGGSSFDLILMDKEMPERDGVSTT
KKLREMEVKSMIVGVTSLADNEEERRAFMEAGLNHCLAKPLTKDKIIPLINQLMDA*

DNA
ATGGCAACAAAATCCATGGGAGATATCGAGAAAATAAAGAAGAAACTAAACGTGTTGATCGTCGATGATGATCCACTAAA
CCTTATAATTCATGAGAAGATCATCAAAGCGATTGGGGGTATTTCACAGACAGCGAATAACGGTGAGGAGGCAGTAATCA
TCCACCGTGACGGCGGCTCATCTTTTGACCTTATCCTAATGGATAAAGAAATGCCCGAGAGGGATGGTGTTTCGACAACT
AAGAAGCTAAGAGAAATGGAAGTGAAGTCAATGATTGTTGGGGTGACTTCACTGGCTGACAATGAAGAGGAGCGCAGGGC
TTTCATGGAAGCTGGACTTAACCATTGCTTGGCAAAACCGTTAACCAAGGACAAGATCATCCCTCTCATTAACCAACTCA
TGGATGCTTGA